KEGG   Escherichia coli O9 HS (commensal): EcHS_A0310
Entry
EcHS_A0310        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: P22_portal
Other DBs
NCBI-ProteinID: ABV04699
Position
313576..315759
AA seq 727 aa
MTDWHRKVLCNFDNAWSATQDMREQIIEAQRFVRVSGAQWEGSTNAGYSFDEGRFEHYPR
FELNKIARECDRIIGEYRQNRISVKFRPKDDKASEALAEKMNGKFRADYQETSGGEACDN
AFDDAVTGGFGCFRMCADYEDEMDPSNEQRRISLLPVYDPATCVFFDQDSKQYDRSDAMW
AMEMFSMTPKAFEAEYPDSIAASLSRDDTGTQYDWSTPDAIYVGRYYEVRIEKVKLTAWR
NPVSGETAIYDEEQIKDIVDELTDGAFELIGERTVKKRRVYCGLLSGAEWLEEPKRIPGE
HIPLIPVYGRRSFVDNQERIEGHAAKAMDAQRLENLMVSMIADNATQAGGDGIPVVDVDM
IPGPLATHWAERNKKRPAFLPMVSLKNKNGDITAQAQVSSYTPPTQMPPALAGLLQYTGT
AIQQITGASQIENMPSNVATDTVDSIFNRMDTQSYIYMDNMAKSMRRAGVVWLSMAREVY
GSDTPMRIVNEDGSDDVALMTGEVVDRQTGQVIALNDLSQGNYEVTVDVGQSFATRRDAT
VKSLLSMLALIPPGTPKHDLVSSMILDNMDGEGMDDLKEYNRNQLLLSGVIKPRTPEEQQ
MVEQAKQQQASQPDPAMVAAQGQLLAGQAELQKAQNEQAAIQVKAFQAQTDAQVAAANVV
KILASADSQQKSDIREALKLLGQFQQQQGDNARADAELVLKSQAQGHAQRMDISSILQKS
TQQQPQQ
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgactgactggcatcgcaaggtgctgtgcaactttgataatgcctggtcagcaacgcag
gatatgcgtgagcagattattgaggctcaacgtttcgtcagggtgtccggcgcacagtgg
gaaggcagcacaaacgctggttactcatttgatgaaggcaggtttgagcattatccgcgt
tttgaactgaataagattgcccgtgaatgtgatcgcatcattggcgagtatcgacagaat
cgcatcagcgttaaattcaggccgaaggacgataaggcatcggaagcgttagccgaaaag
atgaacggcaaattccgcgctgactatcaggaaacatccggtggcgaagcgtgtgataac
gcatttgatgatgccgtaacgggtggattcggttgtttccgcatgtgtgccgattacgaa
gatgaaatggatccgagtaacgagcagcgacgcatcagccttcttcctgtttacgaccca
gcgacatgcgtcttcttcgatcaggacagcaagcaatatgaccgttctgatgctatgtgg
gctatggaaatgttctccatgacgcctaaagcgttcgaggctgaataccctgattccatc
gcggcaagcctttctcgtgatgacactggtactcagtatgactggtcaacgcccgatgcc
atctatgttggacgctactacgaagttcgcatagagaaggtgaagctcacggcgtggcgc
aaccctgttagcggagaaacggcaatttatgatgaagagcaaatcaaagatattgtcgac
gagctgaccgatggtgcattcgaactgattggcgagcgaacggtgaagaagcgccgcgtt
tattgcggtcttctgtctggcgctgaatggctggaagaacctaagcgtattccgggcgaa
catattcctctcatcccggtatatgggcgtcgctcatttgttgataatcaggagcgaatc
gaaggccacgcagcaaaagcgatggatgcacagcgtcttgagaacctgatggtttccatg
attgcagataacgctactcaggctggcggtgatggcattcctgtagttgatgttgacatg
attcctggtcctctcgccactcattgggcggagcgcaacaaaaagcgcccggcgttcctg
ccgatggtcagtctgaaaaacaaaaacggagatattactgcgcaggctcaggtcagcagt
tatacgcctccgacacaaatgcctccagctcttgccgggctattgcagtacaccggaacg
gctattcagcaaattacaggtgcgtcgcagattgagaacatgccgagcaacgtcgccacc
gataccgttgatagcatctttaaccggatggacacgcagtcctatatctacatggacaac
atggctaaatccatgcgtcgcgctggcgttgtgtggctttctatggcgcgtgaggtctat
ggcagtgatacgccgatgcgtatcgttaatgaggacggcagcgatgacgtggcgttgatg
actggtgaagtggttgaccgtcagacagggcaggttatcgcgcttaacgacctttcgcag
ggtaactatgaagtgactgtcgatgtcggtcagtcgttcgctactcgccgtgatgcaacg
gttaagtcgttactttccatgctggcacttatcccaccaggaacgccgaagcacgatctt
gtatcgtcgatgattctcgacaatatggacggcgaagggatggacgaccttaaagaatac
aaccgcaatcagttgcttctgtctggcgttatcaagccgagaacgcctgaagaacagcag
atggttgaacaggcgaaacaacaacaggccagtcagccagatccggctatggttgctgcg
caaggtcagcttcttgctggtcaggctgaattgcagaaagcgcagaacgagcaggcagcc
attcaggttaaagcattccaggcacagactgatgctcaggttgcagcggcaaacgttgtg
aaaatcctcgcatctgccgatagccagcagaaatctgatatccgcgaggctctgaaactg
ctcggacagttccagcaacagcaaggagataatgcccgtgctgatgcagagcttgtcctg
aaaagtcaggcacagggccatgcgcagcgcatggacatcagcagcatcctgcaaaaatca
actcagcaacaaccacagcagtaa

DBGET integrated database retrieval system