KEGG   Escherichia coli O9 HS (commensal): EcHS_A0311
Entry
EcHS_A0311        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04700
Position
315850..316743
AA seq 297 aa
MDQMAENTPEVEIETDASEQIPDDVELAEEVETEDGSESSGNDAEEATETDDDESEQEFY
FGDEKLDSPTSEDGAEHGLVKHLRKTIKEKDRELKELMRQSQKPVEQQPVITQPPRMPKL
DDEDIGFDEEIYQQRMAKWAEDNGKYQQQEMARKQKEQELQAAYQERLSKYQQRVKALKV
PGYQEAEQAVLEEIPIETQNAILFESEKPEIVVLALGRNAELRKQLAEATNPVAIGRLLE
RIESKARIMPKAKTTAATTPTVKGSNGAVINNLDKLKAKALETGDWTPYFAAKKAKK
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaccagatggcagaaaacacaccagaagttgaaatcgaaaccgacgcgtcagagcag
attcctgatgatgtcgaactggctgaagaagtcgaaacagaagatggcagtgagtcctcc
ggcaatgatgcagaggaagctactgaaactgatgacgacgaatcagaacaggaattctac
tttggtgacgaaaagctggattcgccaaccagcgaagatggcgcagagcatggactggta
aaacacctgcgcaagacgattaaagagaaagaccgcgagctgaaagagctgatgcgtcag
tcccagaaacccgtcgagcagcagccggtaatcactcaaccaccgcgaatgccaaaactg
gacgatgaggacatcggtttcgatgaagaaatctaccagcaacgcatggctaagtgggca
gaggataacggcaagtaccagcaacaggagatggctcgcaagcagaaggagcaggagctt
caggctgcctatcaagagcgattatccaaatatcagcaacgtgttaaggctctcaaagtt
cctggctatcaggaagctgagcaggccgtactcgaggaaatccccatcgagacacaaaac
gcgatcctgtttgagtcagagaagccggaaatcgttgttctggcactcggtcgcaacgct
gaactgcgcaagcaactggcagaagctaccaaccccgtagcaattggtcgtcttctggaa
cgtatcgaatcgaaggccagaatcatgccaaaagcaaaaaccacggcagccacaaccccg
acagttaaggggagcaacggcgcagtaatcaataacctcgacaaactgaaagccaaggcg
ctggaaactggtgactggacgccgtatttcgccgctaaaaaggcaaaaaaataa

DBGET integrated database retrieval system