KEGG   Escherichia coli O9 HS (commensal): EcHS_A0312
Entry
EcHS_A0312        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: P22_CoatProtein Big_3_3
Other DBs
NCBI-ProteinID: ABV04701
Position
316762..318015
AA seq 417 aa
MANQLAKDLEIMFENYVEGFEAACVVSRNAKKFRPGDTAMQRAGDVLYRPQHYHMNIEEG
LDLSSKTPTALVQRLVPSVFKEPKNILYTLDAREMRDPEHKTEAGRAAGMRLAAQIDSDL
ISMVTQRATNVITMADSTTGSQGRDLWNCAAGIDATMTAIGVPQGINRRSFWNPFNYKDL
AGELGHRAYAQGTTLTAYEKAQIPPVASFDSYKTDISGRVPKGTATSITLAAAPAHKVEA
KDANDMPVDNRQGTITVSAEGLQVGDAFTIAGVNSVHQITKDTTGQPQVFRVLAVSGTTV
TISPKILPPDNADVASRPYANVDANAASSAAITILNKNAAPANLFWADGSVELMYGKLAF
PTGQGPQVMTATTEQGATLIMSYAFDHIKGVTTARFTTLYGCSVLVPEYTGIVIAGQ
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggctaaccaattagcaaaagaccttgaaatcatgttcgaaaactacgttgaaggcttt
gaggccgcctgcgtagtttcccgtaacgctaaaaaattccgtcccggtgatacagcaatg
cagcgagcaggtgatgttctgtatcgtccgcagcattaccacatgaacattgaggaaggc
ctcgatctcagcagcaaaacgccaacagcactggttcagcgccttgttccttctgtgttc
aaggagccgaaaaacattctgtacactctggatgcgcgtgaaatgcgtgacccggaacat
aaaactgaagctggtcgcgccgcaggtatgcgccttgctgcacagattgactctgacctg
atttccatggttacgcagcgtgctactaacgtgatcacgatggctgactcaaccacaggt
tcacagggccgtgatttgtggaactgtgcggcaggtattgatgccaccatgacggcgatt
ggtgtacctcagggtatcaaccgtcgctctttctggaaccccttcaactacaaagacctt
gctggcgagcttggtcaccgtgcctatgctcagggcacaaccctgacagcatacgaaaaa
gcgcaaatccctccggttgcgtccttcgatagctacaagaccgatatttctggtcgtgtt
ccgaagggtacagcaacttccattacgctggcagcagcacctgcgcacaaggttgaagcc
aaagatgctaacgatatgccagtggataaccgacaggggaccattacggtatctgctgaa
ggtttgcaggttggcgatgcgtttaccatcgcaggggtgaattctgtacaccagatcacc
aaagataccaccgggcagccgcaggtattccgcgttctggcagtaagcggaacgacagta
actatctccccgaaaattctgccgcctgacaacgcggatgtcgccagccgaccatatgca
aacgttgatgctaatgcggcaagtagcgcagcaatcaccattctcaacaaaaatgccgca
ccggctaacctgttctgggctgatggttctgttgaactgatgtacggcaagctggcgttc
ccgactggtcagggtccacaggtaatgacagcaaccaccgagcagggcgctacgctgatc
atgtcttacgccttcgaccacatcaaaggtgtaaccactgcgcgtttcaccaccctgtac
ggttgctctgtacttgttcctgaatatacgggcatcgttattgccgggcagtaa

DBGET integrated database retrieval system