KEGG   Escherichia coli O9 HS (commensal): EcHS_A0313
Entry
EcHS_A0313        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04702
Position
318021..318245
AA seq 74 aa
MGLRPHFYWEKTMARTMLYKPGNMITCGQFAVDYIIVDDEEVKSHLKKGWVKTPEETATK
QKVAKAEEDGENEG
NT seq 225 nt   +upstreamnt  +downstreamnt
gtggggcttcggccccatttttattgggagaagacaatggcacgaacaatgctctataag
cctggcaacatgatcacctgtggtcagtttgctgtcgattacatcattgttgatgacgaa
gaagttaaatctcacctgaaaaaaggttgggtaaaaactcctgaagaaaccgcaacgaag
caaaaagtggctaaggcggaagaagatggcgaaaacgaagggtga

DBGET integrated database retrieval system