KEGG   Escherichia coli O9 HS (commensal): EcHS_A0314
Entry
EcHS_A0314        CDS       T00591                                 

Definition
(GenBank) putative phage protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: P22_Tail-4 Peripla_BP_3
Other DBs
NCBI-ProteinID: ABV04703
Position
318226..318687
AA seq 153 aa
MAKTKGDLVLKALRKAGLYSNATLTDADPQAIEDAINDLEDMMAAWQAKGIELGYQFADT
ENGIMPLPDDDSGIPAWANDGVALKLAVQVCMDNVIQPSDALLTAADSAYQTICIALTKI
PPLERRNDMPRGSGNKSAFTWNRFYIEKDDPST
NT seq 462 nt   +upstreamnt  +downstreamnt
atggcgaaaacgaagggtgatctcgttctaaaggctttacgaaaagccgggctgtattcc
aatgccacgttgacagatgctgaccctcaggcaattgaagatgccattaatgacctcgaa
gacatgatggcagcatggcaggcgaaaggtatcgagcttgggtatcagtttgctgataca
gaaaacggcatcatgccgttacctgacgatgattcaggtatccctgcatgggcaaatgat
ggcgtcgctttgaaactcgctgtgcaagtgtgcatggataacgtcattcagccgtcagac
gctctccttaccgctgctgacagtgcatatcaaacaatctgtatcgctttaaccaaaata
ccaccacttgagcggcgaaatgatatgcctcgcggtagtggtaacaaaagcgcgtttacg
tggaatcggttttacatcgagaaagatgatccgagtacgtga

DBGET integrated database retrieval system