KEGG   Escherichia coli O9 HS (commensal): EcHS_A0315
Entry
EcHS_A0315        CDS       T00591                                 

Definition
(GenBank) putative DNA stabilization protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Phage_stabilise
Other DBs
NCBI-ProteinID: ABV04704
Position
318697..320115
AA seq 472 aa
MPIQQLPLMKGVGKDFRNADYIDYLPVNMLATPKEILNSSGYLRSFPGIAKRSDVNGVSR
GVEYNMAQSAVYRVCGGKLYKGESEVGDVAGSGRVSMAHGRTSQAVGVNGQLVEYRYDGT
VKTVSNWPTDSGFTQYELGSVRDITRLRGRYAWSKDGTDSWFITDLEDESHPDRYSAQYR
AESQPDGIIGIGTWRDFIVCFGSSTIEYFSLTGATTVGAALYVAQPSLMVQKGIAGTYCK
TPFADSYAFISNPATGAPSVYIIGSGQVSPIASASIEKILRSYTADELADGVMESLRFDA
HELLIIHLPRHVLVYDASSSANGPQWCVLKTGLYDDVYRAIDFIYEGNQITCGDKLESVT
GKLQFDISSQYDKQQEHLLFTPLFKADNARCFDLEVESSTGVAQYADRLFLSATTDGINY
GREQMIEQNEPFVYDKRVLWKRVGRIRKNVGFKLRVITKSPVTLSGCQIRIE
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgccgattcagcaacttccgcttatgaaaggtgtcggcaaagacttccgaaacgccgac
tatatcgactatctgccagtgaatatgctggctacacccaaagaaatcctgaacagcagc
ggatatcttcgctcattcccgggcattgccaaacgctctgatgtgaacggcgtatctcgc
ggcgtcgagtacaacatggcgcagagtgctgtttatcgcgtatgtggtggcaagctgtat
aagggcgaaagtgaagtcggtgacgtcgccggaagtggtcgcgtatcaatggcgcatggt
cgaacatctcaggctgtaggcgttaatggtcaactggtcgagtatcgctatgatggtacg
gttaaaaccgtctcaaactggcctacagacagcggattcacacagtacgagttaggttca
gttcgcgatattacgcgcttacgtgggcgttatgcgtggtcaaaagacggcactgattca
tggtttatcactgaccttgaagacgaatcgcatcctgaccgatacagcgcacaatatcgt
gctgagtctcagcctgacggcatcattggcatcggaacatggcgagacttcatcgtctgc
tttggttcatcgacgattgaatatttctccctgactggtgcaaccaccgttggtgcagct
ttgtatgtcgcacagccatcactgatggtgcaaaaaggcatcgccgggacttactgcaaa
acgccattcgctgattcttatgcgttcatcagcaatccggcaactggtgcgccgtctgta
tacatcatcggctccggtcaggtatcaccaatcgctagcgcgagcattgagaaaatcctc
cgctcctacactgctgatgaactggctgatggtgtgatggaatcgctgcgatttgatgct
catgagttgctgattatccaccttccgcgccatgttctcgtgtacgacgcatcttcaagc
gccaatggtccgcaatggtgtgtgttgaaaactggcctgtatgacgatgtgtaccgcgct
atcgacttcatttacgaaggcaatcagataacgtgcggcgataagctggaatcggtgacc
gggaaattgcagttcgacatcagcagccagtacgacaagcaacaggaacacctgctgttt
actccgttgttcaaagcggataacgccagatgcttcgatctggaggtggaatcatccact
ggcgtagctcagtacgccgaccgcctgttcctctctgcaaccactgacggcataaattac
ggacgtgagcagatgattgaacagaatgaaccgttcgtttacgacaaacgtgttttgtgg
aagcgagtagggcgcatcaggaaaaatgtcggcttcaaattgcgcgttatcacgaagtca
cctgtcactctgtctggctgccagataaggattgagtaa

DBGET integrated database retrieval system