KEGG   Escherichia coli O9 HS (commensal): EcHS_A0316
Entry
EcHS_A0316        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Phage_tail_NK MscS_porin ATG16 Crescentin Exonuc_VII_L Fib_alpha XhlA DUF812 Tropomyosin AAA_13 Spc7 DUF16 DUF4407 Filament Tropomyosin_1 Cluap1 ADIP Atg14
Other DBs
NCBI-ProteinID: ABV04705
Position
320115..321068
AA seq 317 aa
MADSNLNVPVIIQATRLDTSVLPRNIFSQSYLLYVIAQGTDVGNVANKANEAGQGAYDAQ
VRNDEQDVTLADHESRIEAAEATLINHEHRIAAAESTLAEHETRITDAETELADHETRIA
ANESELANHDARITQNTADIDALDTRLTAAEGSISTLQSTVGDHSTRISALEYATTRKKS
EVVYSGVSVTIPTAPTNLVSLLKTLTPSSGTLAPFFDTVNNKMVVFNENKTLFFKLSIVG
TWPSGTANRSMQLTFSGSVPDTLVSSRNSATTTDNILLATFFSVDKDGFLATNGSTLTIQ
SNGAAFTATTIKIIAEQ
NT seq 954 nt   +upstreamnt  +downstreamnt
atggcggattcgaatctcaatgtgccggtaatcattcaggctacacggctcgacacatca
gtccttccacgcaatatcttctcgcagtcgtatctgctgtacgttatcgcacagggcact
gatgttggtaacgtggctaacaaagccaacgaggccggacagggcgcttatgatgcacag
gtcaggaacgatgagcaggatgtcacccttgcagaccatgaatccagaattgaagctgct
gaagcaactctcatcaatcatgaacatagaattgcagcagcggaaagcactcttgcagaa
catgaaacaaggattacggatgctgaaacagagctggctgatcacgagacgcgaattgct
gccaatgaatctgagttagcaaaccatgatgcgcgcataactcagaatacagccgatatc
gacgcacttgataccaggctcacagcggcagagggaagtatttcgacgctacaaagcaca
gttggtgatcactcaacaagaatatctgcgcttgagtatgccaccactcgcaagaaatca
gaggttgtttactctggcgtatctgtaaccatcccgacagcgccgaccaaccttgttagc
ctgctgaaaacgctcactccgtcatccggcacgttggcaccattcttcgacaccgttaac
aacaagatggttgtgttcaacgagaacaaaaccctgttcttcaagctgtcgattgtcggg
acgtggcccagtggaaccgccaacaggtcaatgcagctaaccttttccggctctgttcct
gacacactggtaagcagtcgcaactcggcgacaacgaccgataacatcctgttagctacg
ttcttcagcgtggataaagacggctttcttgccacaaatggcagcacgttaaccattcag
tcgaatggtgcggcgtttactgccacaaccatcaagataatcgcggagcagtaa

DBGET integrated database retrieval system