KEGG   Escherichia coli O9 HS (commensal): EcHS_A0317
Entry
EcHS_A0317        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: DUF2824
Other DBs
NCBI-ProteinID: ABV04706
Position
321068..321523
AA seq 151 aa
MIQFKPTRNIDLIEAVGNHPDIITGSNNGDGYDYKPECRYFEVNVHGQFGGIVYYQEIQP
LTFDCHAMYLPEVRGFSKEIGLAFWRYILTNTTVQCVTSFAARKFRHGQMYCAMIGLKRV
GTIKKYFKGVDDVTFYSATREELIDFLNHGR
NT seq 456 nt   +upstreamnt  +downstreamnt
atgattcagttcaaaccaacgcgaaacatcgacctgatagaagccgtgggaaatcacccc
gacattatcaccgggagcaacaacggtgatggatacgactacaagcctgaatgccgttac
ttcgaggtgaacgtgcacgggcagttcggcggcattgtttactatcaggagattcagccg
ctgacattcgattgccacgccatgtacctgccagaggttcgtggattcagcaaggaaatc
gggctggcgttctggcgatacattctgactaacaccaccgttcagtgcgtaacatcgttc
gctgcacgcaaattccgccacggtcagatgtactgcgcaatgattggccttaagcgtgta
ggaacaatcaagaaatacttcaaaggcgtggatgacgtgactttttacagcgccacacgc
gaagaactaatcgacttcctgaatcacgggagatag

DBGET integrated database retrieval system