KEGG   Escherichia coli O9 HS (commensal): EcHS_A0318
Entry
EcHS_A0318        CDS       T00591                                 

Definition
(GenBank) DNA transfer protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: DUF4847
Other DBs
NCBI-ProteinID: ABV04707
Position
321526..322218
AA seq 230 aa
MLYAFKLGRKLRGEEPYCPEKGGKGGSSDKSAKYAAEAQKYAADLQNQQFNTIMNNLKPF
TPLADKYVGSLENLSSLEGQGQALNQYYNSQQYKDLAGQARYQSLAAAEATGGLGSTATS
NQLAAIAPTLGQQWLSGQMNNYNNLANIGLGALQGQANAGQTYANNMSQISQQSAALAAA
NANRPSALQQGVSGAASGALLGGGIASALELSTPWGAGIGAGLGLLGSLF
NT seq 693 nt   +upstreamnt  +downstreamnt
atgttatatgcatttaagctgggcagaaaactgcgcggcgaggaaccttattgccctgaa
aaaggcgggaaaggtggcagttctgataaaagcgcaaagtatgcagcagaagctcagaag
tatgccgcagacctgcaaaatcagcagttcaacaccatcatgaacaacctgaagccgttt
actcctctggctgataagtatgtcggcagcctcgagaacttatcgtctctggaagggcaa
ggtcaggcacttaaccagtattacaactctcagcagtataaagaccttgcaggtcaggct
cgctatcagagtctggcggcagcggaagcaacaggtggattgggttccaccgcaaccagt
aatcagttagcagcaatcgcaccaacgcttggtcagcaatggctatctggacaaatgaac
aattacaacaacctggcaaatatcggtcttggcgctcttcaggggcaggcaaacgccggg
caaacatatgccaacaacatgagtcagatttcacagcaaagcgcggcgctggctgcggca
aacgccaaccgaccgtcagcattgcagcagggtgttagtggtgctgcatccggtgcgctt
ttgggtggtggcatagccagtgctctcgagctatcaactccgtggggtgctggtattggt
gctggtcttggtctgcttggttcactgttttaa

DBGET integrated database retrieval system