KEGG   Escherichia coli O9 HS (commensal): EcHS_A0319
Entry
EcHS_A0319        CDS       T00591                                 

Definition
(GenBank) putative DNA transfer protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Inj_translocase
Other DBs
NCBI-ProteinID: ABV04708
Position
322229..323614
AA seq 461 aa
MATWQQGINSGGFLAGIGAQNENAPKASDINATLGLIRENNELARSGANNVGLTALRGLA
GVADIYKQEQQQKAINAFNKVHADAWASGDPSGLFKFAQENPAFVAQAQQAFSGLNDQQR
NDMGDLAMRANVALSQGPEAYSKFITDNKDRLNRVGANADWMIQTGIQNPEQLSHMLTTM
SLGALGPEKAFAVQDKMAGREIDRGRLAETIRSNQAGEALQARGQNLSYQSAMTGHGLAA
ERLALDKQKFGFEVQQAQKKADELINAAPKLSVNMEKAIEKSAGDAAASRNAADSMTTLA
DTLEKEKPTPGLFGNAENMFTKLTGQDNYLRDMRIRFNQLANAQATKLLPPGPASDKDIE
FARKGIPSETDNPMVMARWLRGMAKMESNNAKFNEFRSEWMSANGSPGQSDRNRNIMGMD
VKKGESLNSAAKRFLSSSYGDSQPQQQLSDDELISKYLGGQ
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggctacgtggcaacagggtattaattctggtgggtttcttgctggcatcggtgcgcaa
aatgagaatgcgccaaaggcaagcgacattaacgcaacgcttggtctgatccgcgaaaac
aatgaactggctcgctcaggtgcaaataacgttggtctgaccgcgttacgtggtctggct
ggagttgctgatatttacaagcaggaacagcaacagaaagcgattaatgcgttcaataag
gttcatgctgatgcatgggcttctggtgatccatcgggactatttaagtttgcccaggaa
aatccagcgtttgttgcacaggcacaacaggcgttttctggtcttaatgatcagcaacgc
aacgatatgggcgatttagccatgagggctaacgtcgctctttctcagggaccggaagcc
tacagtaaattcattactgacaacaaggacaggttaaatcgcgttggtgctaatgctgac
tggatgattcagacaggtatccagaatccagagcagctatcacacatgctgactactatg
tctctcggtgcgcttggaccagaaaaggcgtttgctgttcaggataagatggctggtcgt
gaaattgaccgaggcaggctggcagagacaatccgcagcaatcaggctggcgaggcactt
caggcgagagggcaaaacctttcctatcagtcagcaatgactggacacggacttgcagca
gaaagactggcacttgataagcagaaattcggttttgaagtacaacaggcacaaaagaag
gccgatgaacttattaatgctgcgccaaaactatccgtgaacatggaaaaggctatagaa
aaatcagcaggtgatgcggcagctagtcgtaatgctgccgattcaatgacaacgcttgct
gacacgcttgagaaggagaagccaactcctggtttgttcggtaacgctgaaaatatgttc
actaagcttacggggcaagataactacctccgagatatgcggattagattcaaccaacta
gccaatgcgcaggcaaccaagcttctcccccccggccctgcatcagataaggatattgag
tttgcaaggaaaggcattccaagcgaaacggataatccaatggtcatggctcgatggtta
aggggtatggcaaaaatggaaagtaataacgcgaagttcaacgagtttaggtcagagtgg
atgagtgcaaatggcagcccaggacaatctgatcgcaaccgaaacatcatggggatggat
gttaagaagggtgaatcattgaactctgcggcaaaacgttttctttcctcaagttatggc
gatagccaacctcaacagcaattgtccgatgacgaattaattagcaaatatctcggaggg
cagtaa

DBGET integrated database retrieval system