KEGG   Escherichia coli O9 HS (commensal): EcHS_A0320
Entry
EcHS_A0320        CDS       T00591                                 

Definition
(GenBank) putative injection protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04709
Position
323614..325440
AA seq 608 aa
MAYSREQLMTALRNADAAGDTEGARRIAQMLSSGDQSTQNQSQPEEQSLVGKATDWLTGG
QSAGQIAEQAGRGLVNIPFDVLQGGASLINAISQGLGGPKVLDDVYRPVDRPTDPYAQAG
ETIGGYLVPGVGTAGSMAIGSLAEAANQKGDFAQNAAKNAGVNLAAQGVLSAAAKGIGRG
ITAIKGDIAPEVAKKIATSESMGVTPMTSDVIPPKNAFTRGLTQDAEGALLGTGSKRAEQ
YATRSKLVSNYFDRFGEYNPDDVVKSLTTTLRGRKDAAGAVINDVTNKMGNAAVDTTNTM
NALNTAIARQERLGTSANQSLLTSLRNLREELANPATDLDVTFDLLRQHRTAFRSNVQGD
AMVFPNQAKAATNMVENAMSKDLRNAVAKNLGASDAAKYLKANSDYANVYNKVLNKNIAN
KLNKASSEASPELINTVVLSRKPSDVKRIWSALDDKGKDAMRAAYVSKIAEKAGDSPAKF
ITEVNKLKSQSGGEIYNTIFSGKHMKELDALNEVLQQTARSDTANVVTQTGQSQANRIRT
IGATATLGVSMGLEAGFGAMMRLYESKAARNALLRLANTKAGTPAYERALNNAANAIRPI
LANDATDR
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggcctatagtcgtgaacagttgatgacggcgttaaggaatgctgatgctgccggcgat
actgagggggcacgtcgcattgctcagatgctgtcttctggtgatcaatccactcaaaac
caatcgcagccagaagaacaatctctggtgggaaaagctactgactggctcactggtggt
caaagtgcagggcaaattgcagaacaggctggccgtggtctggtaaacataccatttgac
gtattgcagggtggcgcaagtctgattaatgcaatcagccagggtcttggtggccccaag
gttttggatgatgtttatcgtccagtagatcgaccaacagacccttatgcgcaagctgga
gaaacaattggcgggtatttagttccaggagttggaacggcaggaagcatggctattgga
tcactggcagaggccgcaaatcagaaaggcgatttcgcacaaaatgcagccaaaaatgcc
ggagttaaccttgccgctcagggtgttctttccgcagcagcaaagggaatagggcgtgga
ataacggctataaaaggtgatattgcgccagaagtggcgaagaaaattgccacatcagaa
tcgatgggcgtgacaccaatgacatctgatgttatcccgccgaaaaatgctttcactcgt
ggccttactcaggatgccgagggggctttgctcgggacaggctcaaagagagcggagcaa
tatgcaacgcgtagtaaactggtaagcaattattttgaccgttttggtgagtacaaccct
gatgatgtggtgaaatctcttaccaccacgttaagggggcggaaggatgccgctggcgct
gttatcaatgacgtcaccaataaaatgggtaatgccgcagttgataccacaaataccatg
aatgctctgaatacagcgatcgcaagacaggaacggcttgggacgtctgccaatcaaagc
ctgcttacatccttgcgtaacctacgtgaagaattagcaaaccctgcaactgatttggat
gttacgtttgatctcttgcgtcagcacagaacagcatttagatctaatgttcagggagat
gctatggtcttccccaaccaggcaaaagcagctaccaatatggtagagaatgcaatgtca
aaagaccttcgtaacgcagttgctaaaaacctcggtgcatcagacgcagcaaaatacctt
aaagcaaattccgattatgcaaacgtttataataaggtgcttaataaaaacattgccaac
aagctcaacaaggcaagcagtgaagccagtcctgaacttataaataccgttgtattaagc
agaaaaccatctgacgtgaaacgaatctggagcgcactggatgataaagggaaagatgct
atgcgtgcagcttacgtcagcaaaatagcggaaaaggccggcgactctccagccaagttc
atcactgaagttaataagctgaaatctcagtcaggaggtgaaatttacaacactattttt
tctggaaagcacatgaaagaacttgatgctcttaatgaagttctacagcaaacagcaagg
tcagacaccgcaaatgtagtaactcagacggggcaatcgcaagccaacaggataaggacg
attggcgcaactgcgactcttggcgtatcaatggggcttgaggctggtttcggtgcaatg
atgcgcttgtatgagtccaaagcagcaaggaatgcgctcttacgtctggcaaacactaaa
gctggaacgccagcctatgaaagagcgctgaataacgccgcaaatgccatcagaccaata
cttgccaatgatgcaactgatcgctaa

DBGET integrated database retrieval system