KEGG   Escherichia coli O9 HS (commensal): EcHS_A0321
Entry
EcHS_A0321        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: EI24 DUF3810 DUF3918 Vma12
Other DBs
NCBI-ProteinID: ABV04710
Position
complement(325462..326133)
AA seq 223 aa
MFCSKLRSGYSMKKIDIYSDTSAYVIGSLGFLIFFVWQYQSLSPGWRFLGMSLISLGAGI
ATQVLMYLFNGWISKRVEKKRATSICRSLAIPEDSTDQDDIAKCWRYMIARYSNELLANR
LSDLIGIVVTSVGTIISIGISIWYVGMIVYFVWNRDFNEPSLLFIPLFFRVLAFICELLL
SFFCNVLFNRYPGEARKFNKNYDELRRTDPFLSSKEFRDSIRN
NT seq 672 nt   +upstreamnt  +downstreamnt
gtgttctgctcaaaactaaggagtggctactcaatgaaaaaaatagatatatatagcgat
acatcagcctatgtcataggctcattgggttttttaattttttttgtttggcagtaccag
tcactatctccaggatggagatttttggggatgtctttgatatcacttggtgcaggaata
gcaacgcaggtgttgatgtatctctttaatggatggatctcaaaaagagttgagaaaaaa
agagctacttcaatatgtagaagcctagctattccagaagactctacagatcaggatgat
attgcaaaatgttggcggtatatgattgcaagatactcaaatgagttactggcaaacaga
ctgtccgacttaatcgggatcgtagttacctctgttggaacaatcatcagtatagggata
tcaatttggtatgtcgggatgattgtctattttgtttggaatagagacttcaatgaacct
tcccttctttttatacctttatttttcagggtattagcattcatatgtgagttattgctc
tcttttttctgcaatgttttgttcaacagatacccaggtgaagcaagaaagtttaataaa
aactatgatgagttaaggagaacagatccttttctatcaagcaaagagttccgcgattcc
attcgcaattaa

DBGET integrated database retrieval system