KEGG   Escherichia coli O9 HS (commensal): EcHS_A0322
Entry
EcHS_A0322        CDS       T00591                                 

Definition
(GenBank) helix-turn-helix/peptidase S24-like domain protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Peptidase_S24 HTH_3 HTH_19 HTH_31 HTH_26 MqsA_antitoxin
Other DBs
NCBI-ProteinID: ABV04711
Position
complement(326165..326806)
AA seq 213 aa
MNFDDQFPSRVSLARQSRGMTQAQLSKLAGVVQRQIAAYEGGEAKPRLRVLQALANALGT
TAEWLALGEGQGPGTKNVMPDVLVKQIPILKLDEVMHYLNTGEHSSSRFHPAIYNVGDSA
FALTIEGEAMTTSSGISFPRGSVVTFSPLVKAKSKDYVIASLDKEQILSFKQVYIGEIET
NLVSLNPMYPNILVRNEDVSILATAVYLEIPLL
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaattttgacgatcaattcccatcaagagtatctctggcaagacagtccaggggtatg
acgcaggcgcagttgtcaaaattagctggtgttgttcaacgtcaaatagctgcatacgag
ggtggtgaggctaaaccacggcttcgtgtattgcaggcattagccaacgcattaggcact
acggctgagtggttagctctgggtgaaggtcaggggcctggaacaaaaaacgtcatgcct
gacgttctggtaaagcaaataccaatcctcaaactagatgaagttatgcattacctaaac
acaggtgaacattcatcgtctagatttcatccggcaatatacaatgttggtgactctgca
tttgcattgactattgaaggtgaagctatgactacaagttcaggtattagctttcccaga
ggatcagttgtcacgttcagccctctagtaaaagctaaaagcaaagattatgtaatagca
tcattggataaagagcaaatattgagcttcaagcaggtttacattggtgaaatagagaca
aacttagtatccctaaacccaatgtatcctaatattcttgttagaaatgaagatgttagt
attttggcaaccgcagtttaccttgaaatcccgttgctttga

DBGET integrated database retrieval system