KEGG   Escherichia coli O9 HS (commensal): EcHS_A0323
Entry
EcHS_A0323        CDS       T00591                                 

Definition
(GenBank) putative phage protein
  KO
K07741  anti-repressor protein
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    EcHS_A0323
SSDB
Motif
Pfam: P22_AR_C Bro-N PH_9
Other DBs
NCBI-ProteinID: ABV04712
Position
327153..327779
AA seq 208 aa
MNIVAKSDYNFHGVELVPTRDMHGVWFTSSNIASALKYANSRAVTMIYNKYSDEFSAGMT
QVLEVSTSGNYRKKVRVFSLRGAHLIAMFARTPVAKEFRRWVLDILDRQAECSPIAKQFT
DEELVNLCYLQLWMEKSQQMCKHIYPGMKQIGSELSGRIYDIAYETRYMSEETKKSLLRE
MKNLDTNNFVVKNAQPMLTKLRGEEWIH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaatattgtagcaaaatcagattacaacttccacggagttgagttggtgcccacccgt
gatatgcatggtgtttggtttacatcatctaatattgcatctgcacttaaatatgcaaat
agccgtgcagtaacaatgatttataacaagtatagcgatgagtttagcgccggaatgact
caggtactcgaagtgagtacctcaggaaattatcgcaaaaaagtgcgagttttctcacta
cgcggtgcccacctaatcgcgatgtttgctcgcactccggtagccaaagagttccgccgc
tgggtgctggatattttggatcggcaggcagaatgctcaccgattgcaaaacagtttact
gacgaagaactggttaatctctgctacttacaattgtggatggagaagagtcaacaaatg
tgcaaacacatctacccaggaatgaagcaaattggttctgagctttcaggaagaatttac
gatattgcatatgagactcgctatatgtcagaagaaaccaagaaatcacttcttcgtgaa
atgaagaatcttgataccaacaattttgtcgtaaagaacgctcagccaatgctgacaaaa
ctgcgcggcgaggaatggattcattga

DBGET integrated database retrieval system