KEGG   Escherichia coli O9 HS (commensal): EcHS_A0324
Entry
EcHS_A0324        CDS       T00591                                 

Definition
(GenBank) putative membrane protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: HTH_31
Other DBs
NCBI-ProteinID: ABV04713
Position
327868..328461
AA seq 197 aa
MTLKNVANIGSVVTDKTIDSQSLLMMVNEARKLCGEPSVRNNKFIEKIEDELEGETYTKS
VGRKNGADIDVISMTIKQALRVAARESKAVRRTLVDKLESMQEAHIKSGKSSSGLVEYRQ
ARTLKMTVEAVTNLLDLMPNLAPEAKQTAAASIINPIVGFNAIPLPAIEEHYYSAGEVAE
QLGVTANKIGRIANANN
NT seq 594 nt   +upstreamnt  +downstreamnt
atgactttgaagaatgtagcaaacatcggatccgttgtcacggataaaaccattgacagc
caaagtcttctgatgatggttaatgaagctcgcaagttatgtggagagccatcagtacgt
aacaacaaattcatcgagaaaattgaggatgaattggagggcgagacctacacaaaaagt
gtaggtcggaaaaacggggctgacattgatgttatctccatgactatcaagcaggcgctt
cgtgttgctgctcgcgaatctaaagcagttcgccgaacacttgtagacaaacttgaaagt
atgcaagaagcgcacattaaaagcggtaaatcgtcgagtggacttgttgagtatcgccag
gctcgaacattgaaaatgacggttgaagctgttaccaatctgttagatttgatgccaaat
cttgcgccggaagcaaagcagactgcggcagcaagcataatcaacccgatagttggtttt
aatgcaatacctcttccagcaatagaagagcattactactcagcaggggaggttgcagag
cagcttggagtaacggcaaacaagattggtcgcattgctaacgcaaacaactga

DBGET integrated database retrieval system