KEGG   Escherichia coli O9 HS (commensal): EcHS_A0325
Entry
EcHS_A0325        CDS       T00591                                 

Definition
(GenBank) ISEhe3, transposase orfA
  KO
K07483  transposase
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    EcHS_A0325
SSDB
Motif
Pfam: HTH_Tnp_1 Terminase_5 HTH_23 HTH_28 HTH_Tnp_ISL3 MAD DUF4140 GAS TEX13 HTH_Tnp_IS630 Snapin_Pallidin CENP-B_N Takusan Lzipper-MIP1 DivIC vWA-TerF-like Val_tRNA-synt_C zf-CCCH_6
Other DBs
NCBI-ProteinID: ABV04714
Position
328522..328800
AA seq 92 aa
MSGKRYPEEFKTEAVKQVVDRGYSVASVATRLDITTHSLYAWIKKYGPDSSTNKEQSDAQ
AEIRRLQKELKRVTDERDILKKAAAYFAKLSD
NT seq 279 nt   +upstreamnt  +downstreamnt
atgagcggtaagcgttatcccgaagagtttaaaactgaagcagtcaaacaggttgttgat
cgcggttattctgttgccagcgttgcaacacgtctcgatatcaccacccacagcctttat
gcctggataaagaagtacggtccggattcttccactaataaagaacagtcagatgctcag
gccgagatccgccgtctccagaaagagctgaaacgggttaccgacgaacgggacatatta
aaaaaagccgcggcgtacttcgcaaagctgtccgactga

DBGET integrated database retrieval system