KEGG   Escherichia coli O9 HS (commensal): EcHS_A0327
Entry
EcHS_A0327        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Head_binding Beta_helix
Other DBs
NCBI-ProteinID: ABV04716
Position
330240..332150
AA seq 636 aa
MTDTNYLISMPSTPFSAPRAFKSVANGKIYIGNPDTDPVNPANQIPVYAVNENGSEVQVS
QPIIINAGGFPVYNGQIMKFITKQNFSMAVYDAYGAQQFYWINVANMDPNSAYLEAVNDV
LAMLGSSDGAKLIGGMSFLTAEMYSHLVEGMDWRKAIQAAIDQAHQNYLAGSGPTNILIG
GEFSVTLNPNSTLIPGEVAAGRGALCMRSGVTLMGGGAITLDGNFTGSASGAIITNWEGA
ADNCKIQGITLNGSRGTAAGTGITCINILDSDNVTIDNVKAIDSTSGGIYLRRANNTVYG
CSNSRIMNCYVHNVEYIGIQCERPNGMTITGCAVASCGDNGIDIFGNVTDESGQGVAEDV
VVSNNTIRDVSVGVFIESCGNVAISSCRISGFSNSGVFFNRINTAAYNCSVIGCTITGAD
ITSSQGIRWKNAVGYTRVYNNTLKNCIDSFVTTGGMIYVDIGVNNHESIGRCFLYVPKKS
NGCVYTRMVQQVYNGVQTDGIPYNTTPRGWPSANNTRYYRCSFTAPYMMYSATTGEDNLI
RATGNLPFNSGWGPAYSLYNTIVSGETVIAMGSSLLSAGEYMLINGYYYLVYSVTSSYAV
VRKWDVSSQDYIAGDYTSYLNSAYAYSIFRAAWGTL
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgactgacaccaattacctgatctctatgccgtctacacctttttcggcgccacgagca
tttaaatcagtggcgaacgggaaaatctatatcggaaaccctgacactgacccggtaaat
cctgctaaccaaattccggtatatgccgttaatgagaatggatccgaggttcaggtttct
cagccaatcatcattaacgctggaggcttccctgtttataacgggcagattatgaagttc
atcaccaaacagaacttcagcatggcggtgtatgatgcatatggggcgcagcagttttac
tggattaatgttgcaaatatggacccaaactctgcgtatctggaagcggttaatgatgtt
cttgcaatgctgggctcaagcgatggcgcaaaactgataggtggaatgagctttcttaca
gcggaaatgtactctcatcttgttgaagggatggactggaggaaagcaattcaagctgct
atagaccaagctcaccagaactatttagccggaagcggcccaaccaatattctcattgga
ggtgaattctccgttactctcaatcctaattcaactttgatacctggtgaggttgctgcg
ggtcgaggtgcgctgtgtatgcgtagtggtgtaacactgatgggcggcggagcaatcacg
cttgatggcaattttactggctcagccagcggcgcaatcattacaaactgggaaggcgcc
gccgataactgcaagattcaggggatcacgcttaacggcagccgtggcaccgctgccgga
acggggattacctgcattaatatcttggactcggataatgtcactattgataacgttaag
gcgatagatagcacttctggagggatttatttacgccgagctaacaatacggtttatggc
tgttctaactcaagaattatgaactgctacgttcacaacgttgaatatattggcattcag
tgtgaacgccccaacgggatgaccattacgggatgtgccgtagcctcctgcggtgataat
ggcattgatatctttggtaacgtaactgacgaatctggacagggagttgcggaggatgtt
gttgttagtaataacactatccgtgatgtaagcgtaggagtgttcatcgaatcatgcgga
aacgtggcaatatcttcgtgccgtatttcaggatttagtaactctggtgttttctttaac
cggataaatacagctgcgtataattgttctgtaattggatgcacgataacaggggcggat
attacctccagccagggcatccgctggaagaatgcagttggttacactcgcgtttataac
aacacactaaaaaactgtattgactcctttgtgacaactggagggatgatttacgttgat
attggggtgaataaccatgaaagcattggcaggtgttttctttacgttcccaaaaaatct
aacggatgtgtctatacaagaatggttcagcaggtctacaacggagttcagacagatggc
ataccgtacaacacgacacctcgtggttggccatccgcaaacaacactaggtactatcgc
tgttcattcaccgcgccgtacatgatgtattccgctacgactggggaagataacctcatt
cgggctacaggcaatttgccattcaacagtggctgggggcctgcttactcgctatacaat
acgattgtttctggagaaacagtaatagccatggggagctcgctactgtctgccggtgaa
tacatgctaataaacggttattattatttagtttatagcgtcacatcatcctatgctgta
gtaaggaaatgggatgtatccagtcaggactatattgccggagactacacatcttattta
aatagcgcatacgcatattccatcttcagagctgcttggggaacactatga

DBGET integrated database retrieval system