KEGG   Escherichia coli O9 HS (commensal): EcHS_A0328
Entry
EcHS_A0328        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K03503  DNA polymerase V [EC:3.4.21.-]
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecx01002]
    EcHS_A0328
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecx03400]
    EcHS_A0328
Enzymes [BR:ecx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     EcHS_A0328
Peptidases and inhibitors [BR:ecx01002]
 Serine peptidases
  Family S24: LexA family
   EcHS_A0328
DNA repair and recombination proteins [BR:ecx03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    EcHS_A0328
SSDB
Other DBs
NCBI-ProteinID: ABV04717
Position
332857..333174
AA seq 105 aa
MGFPSPAADYVEQRLSVNSICNVGPNTRVFERDGGYVVLDISLKPKQGSQVLIQHGGGTE
LATLRGRALITEDGEAIEGEALDDITVAGVVTHTIIDVRSDSVAV
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggctttccttcacccgcagcggactacgtcgagcagcgactgtccgttaactcgata
tgcaatgttggtcctaacacccgcgttttcgaaagggatggcggttatgttgtgctggat
atctccctgaagccaaagcagggtagtcaggttctgatccagcacggcggcgggactgag
cttgccacgttgagagggagggccctgattactgaagacggcgaagcgattgaaggcgag
gccctggatgatatcactgtcgccggcgtggtgacacacaccatcatcgatgtgagaagt
gacagcgtagcggtataa

DBGET integrated database retrieval system