KEGG   Escherichia coli O9 HS (commensal): EcHS_A0329
Entry
EcHS_A0329        CDS       T00591                                 

Definition
(GenBank) site-specific recombinase, phage integrase family protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Phage_integrase Arm-DNA-bind_3 Phage_int_SAM_3
Other DBs
NCBI-ProteinID: ABV04718
Position
333837..335045
AA seq 402 aa
MKLNARQVDAAKPREKAYKLADGAGLYLEVVPSGSRYWRMKYRFNGKEKRMAFGVYPAVS
LAQARALRDDAKKKLAEGIDPSLAKKEEKLVRDVQLNNTFQAVALEWHGTKVSRWSEGYA
SDIIEAFNKDIFPYIGQQPVNEIKPLVLLNVLRRIESRGATEKAKKVRQRCSEVFRYAIV
TGRAEYNPAADLTSAMSGHESKHYPFLTVEELPDFFKALAGYTGSPLVVLAARLLILTGV
RTGELRGAFWSEFDLEKAVWEIPAERMKMKRPHLVPLSTQALEIVQQLKVMSGQYPLVFP
GRNDPRKTMSEASINQVFKRIGYTGRVTGHGFRHTMSTILHEEGFNTAWIETQLAHVDKN
AIRGTYNHALYLEGRREMMQWYADYINANHNSCISLLVNATK
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaaacttaatgcgcgacaggtagacgcagctaaacccagagagaaagcctataagctg
gcagatggtgctggtttgtatcttgaggttgttccctctggttccagatactggcggatg
aaatatcgcttcaatggaaaagagaagcgtatggcctttggtgtctatccggcagtgtcc
cttgcacaagcgagggcactgcgtgacgacgccaagaaaaagcttgccgaaggtatcgat
ccatcgcttgccaagaaagaagaaaagctggttcgagatgtgcagctaaataatacgttt
caggctgtggcacttgaatggcatggaacgaaggtgagccgatggtcagaaggttatgcc
tcggacattatcgaagcctttaataaagatatttttccctatattggccaacaaccggtg
aatgaaatcaaaccgctggttctgcttaatgtgctgcgtcgaattgaaagccgtggcgcg
acagagaaggccaagaaggttcgccagcgttgcagcgaagtctttcgttacgccatcgta
accggtcgtgcggaatacaatcctgcagcggatcttaccagcgcgatgtcagggcatgaa
tcgaagcattatcccttccttactgttgaggagttaccagacttttttaaagctctcgca
ggctacacaggaagcccgttagttgttcttgcggcacgtctgctgatcctcacgggagtt
cgcactggcgaactccgaggtgctttctggagtgagtttgatcttgaaaaagcggtgtgg
gagatacctgccgagcgtatgaagatgaaacggcctcaccttgtccccctctctacccaa
gcgctggaaatcgtacagcaactcaaagtgatgtcagggcaatatccactggtgttcccg
ggacgtaatgatccccgcaagacgatgagtgaagcgagtattaatcaggtttttaagcgg
attggatatacggggagggtaacggggcatggtttccgtcacacgatgagtacgattttg
catgaggaaggtttcaatacagcgtggattgaaacccagctggctcacgttgataaaaat
gcgattcgtgggacgtataaccatgcgttgtatttggaaggacgtagggagatgatgcag
tggtatgcggactatataaacgctaatcataattcatgtatttctttgctggtgaacgct
acaaagtag

DBGET integrated database retrieval system