KEGG   Escherichia coli O9 HS (commensal): EcHS_A0330
Entry
EcHS_A0330        CDS       T00591                                 

Definition
(GenBank) putative DNA Methylase family
  KO
K03427  type I restriction enzyme M protein [EC:2.1.1.72]
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ecx02048]
    EcHS_A0330
Enzymes [BR:ecx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     EcHS_A0330
Prokaryotic defense system [BR:ecx02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   EcHS_A0330
SSDB
Motif
Pfam: N6_Mtase MTS Methyltransf_31 Methyltransf_25 Cons_hypoth95 Rap1-DNA-bind Eco57I N6-adenineMlase
Other DBs
NCBI-ProteinID: ABV04719
Position
335287..336495
AA seq 402 aa
MNSNYMPFTQRDSLGRYYTKESISALLVSQMKAEKVNNIIDLASGEGSLTYAALDRWKNA
EAYSLDIESRMSKKVCDNLTHIVTDALVHSFPEMLARHQGNFDVAVCNPPFTLPEWRDDY
FKIISEIGADKYISVSKYVPAEIIFISQVIRFLKKGGEAGIILPDGIFTARKFIGLRRYL
LNEHSITKVIELPRNIFKRTEAKTHILIFNKKIMPHHKIQLHCITKDGELSPPVLIRKED
AVERMDYSYHYNKNEGKGFSTIGMLKNISIFRGRFNSKEITEHVFHTTKFSGDEKYIKFH
CNSVEELKPSKLDVIAKPGDILIARVGRNFHKKILFVESGYSYISDCIFLIRASGGDKKK
LFDFLCSQDGQEELSRASSGVAAQHITMDALKKIHLVRIKHD
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgaacagtaactatatgccattcacacaacgagatagtctcggaagatactatacaaaa
gaatccataagtgcattattggtttctcagatgaaagctgaaaaagtcaataatattatt
gatttagcttctggtgaggggagcttaacctatgctgctttagaccgatggaagaatgca
gaagcatattctttggatatagaatctcggatgtcaaaaaaagtatgtgataatcttact
catattgtaacagatgcccttgttcattcatttcctgaaatgcttgcccgacatcaagga
aattttgatgttgcagtatgtaatcctccattcactctccctgaatggagggatgattat
tttaaaatcattagtgagattggcgcagataaatatatatctgtctcaaaatatgtccca
gcagagataatatttatatctcaagtcatcaggtttcttaaaaagggcggtgaggctgga
ataattttacctgatggtatatttacagcaagaaagtttataggtttaagacgatattta
ttgaatgaacattcaattacaaaagtcattgaattgcctaggaatatcttcaaaaggaca
gaggctaaaacacatattttaatttttaataaaaaaattatgcctcatcataaaatacaa
ttacattgtataactaaagatggggaattgtcgcctcctgttttaattagaaaagaagat
gcggttgagagaatggactactcttatcattataataaaaatgaaggtaaagggtttagc
acaatagggatgcttaaaaatatttcaatttttagaggtaggtttaattcaaaggaaatt
acggaacatgtttttcatacgacaaaatttagtggtgatgaaaagtacattaaattccac
tgcaactctgtagaagaattgaagccatcaaaattagatgtcattgctaagcctggtgat
atattaatagcaagagttgggcgaaattttcataaaaaaatattgtttgttgagagcggc
tattcttatatcagtgactgtatttttctgatacgagcctctggtggagataagaaaaaa
ctatttgattttctttgttctcaagatgggcaagaggaattatctcgagcgagtagtggt
gtagccgcacaacatattacaatggatgcattaaaaaaaatacatcttgtaaggattaaa
catgactga

DBGET integrated database retrieval system