KEGG   Escherichia coli O9 HS (commensal): EcHS_A0331
Entry
EcHS_A0331        CDS       T00591                                 

Definition
(GenBank) putative membrane protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: ATPase_2 zf-ribbon_3 AAA_16 DZR AAA_14 NOB1_Zn_bind NB-ARC HHH_5 AAA_22 zinc_ribbon_2 DUF4125 Auto_anti-p27
Other DBs
NCBI-ProteinID: ABV04720
Position
336488..338194
AA seq 568 aa
MTDVELDSNFLIEERADYIDEDTIKNNTIRSGEFFDIIHNALISPGIKLIVGPRGCGKTH
LMRYAWVECKNDDNAPLPLYVSFNKYFKLEPLLKNKPNAIDLFHKWVLAKILLSAYEIAC
DIEDSEYLDLSTILIADKEFLINLIVRLEQGLSPSLEQENIVQLISVSSVISSLSSLCDW
LERKRVIILLDDAAISLTPEYLYEFFDIVRSLKTSKIALKASVYPGTTEYGPRFHVAHDA
ETIDAWISVQHPNYSSVMDAIAQARFPGYDGIPDDLKELFKFSAFGIPRSFLMMLRDYQT
TLSQTTQQKFNKIIERYVELRLSEYSSLKDKLPRLFDIVSLGESLLLKVVELLKESNSQY
KEEKQVIIGIEKNDNVYFSRLTKLLIETGLFYNLPDISHGDGRTYERYIPHYALLIKERV
FNEGSRGFSPSQIIQKILRKNAKHPVRRNISSLFNAEQLARLKLTLPPCNNCKTPRLTDN
QKFCHHCGNQLIDESAYNQCMSIPLSKVPHLTSWQMQKLSGLEKVKTIGDVLSLQDPGSE
LRKIHRIGPKIANKIMDKVLLHVEEFLS
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgactgatgtggaattagatagtaattttcttatcgaggaacgagctgattatattgat
gaggatacgataaaaaataatactatcagatctggagagtttttcgatattatacataat
gctcttatatccccaggcatcaaacttatagttggtcctaggggatgtggtaaaacacat
ttgatgcgttatgcttgggttgaatgtaaaaacgatgataacgcaccattaccactctat
gtttcttttaataaatattttaagttagagccgcttttaaaaaataaaccaaatgcaatt
gatctctttcataaatgggtattagcaaagatactactctctgcttatgaaattgcttgc
gatattgaagattctgaatatcttgatttgtcaacgatactcatagcggataaagagttc
ctaattaatttaatcgtaaggcttgagcagggtctttcgccatcattagaacaagaaaac
attgttcaattgatcagtgtttcttctgtcatatcctcgttgagttcactatgtgattgg
cttgaacgtaaaagagtcattattttattagacgatgcagcaataagcttaactcctgaa
tatctttacgagttttttgatattgtacgtagtctaaaaacctcaaaaatagctttaaag
gcatcggtttatcctggaacaaccgaatatggcccaaggtttcatgttgctcatgatgct
gaaacaattgatgcttggatttcggtacagcaccctaattattcctcagtgatggatgct
atagcgcaggcaaggtttcctgggtatgatggcattccggatgacttgaaagagttattt
aaattctcagcatttggtattccacgttcttttttgatgatgttaagagattatcaaaca
actttaagtcagacaactcagcaaaaatttaataaaataattgaaaggtatgttgagctt
agactcagcgaatacagttcactaaaagataagctacctcgattgtttgacattgtttca
ttaggtgaatcacttttattaaaagtagtcgaattactcaaggaaagtaactcccaatat
aaagaagagaaacaagtcataatcggtatagagaaaaatgataatgtttatttttctcga
ctcactaagctattaattgaaacagggcttttttataatcttcctgatatttctcatggt
gatgggcgtacttatgaaagatatatacctcattatgctttattaataaaggaaagagtg
tttaacgaaggaagtagaggtttttctccttctcagattattcaaaaaatactaagaaag
aatgctaagcatcctgtcagaagaaacatttcatcattattcaatgctgagcaacttgcg
agacttaaactaactttacctccatgcaataactgcaagactccgcgattgactgacaat
caaaaattttgccatcattgtgggaatcaattgattgatgagtcggcctataatcagtgc
atgtctattccactgtcaaaagtaccacatctaacatcttggcaaatgcaaaaactatct
gggctggaaaaagtaaaaactataggagatgtattgtctttacaagaccctgggagtgag
ttaagaaaaattcacagaataggacccaaaattgccaataaaattatggacaaagtgtta
ttacatgttgaagagtttttgtcttaa

DBGET integrated database retrieval system