KEGG   Escherichia coli O9 HS (commensal): EcHS_A0332
Entry
EcHS_A0332        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04721
Position
338139..339242
AA seq 367 aa
MPIKLWTKCYYMLKSFCLNFDGMYLSIVSFLSEKFNLKRVGKMELESKEDYEETTHHNVA
SSVVTATHDNLDGREFFELCSNPALVFSFETHKKFNELPVDSKESPLDLFIANTKQLHLL
RSGDISNTLSHLLLLGYVSAAESYLRALIRNLINHDEYIQSIVSDKAVSYAAAQHHKKEL
LPEALLEDFSLASPYNVFETLKDIIGMKGQRPIEMMKCSSEFMKVCELRHCCVHRFGKLG
SKNAIRLGLAEHMKHLEKPIILNNDDLEQIAFIVENFIRTLNNTVFKFIINRTVENKNKE
KGGERLYDSEWTWVFEKDISRYEKYYSIFSAKNDTLPGLSLQDSYQLFVNAYKPKLPARK
NKKTEEN
NT seq 1104 nt   +upstreamnt  +downstreamnt
ttgccaataaaattatggacaaagtgttattacatgttgaagagtttttgtcttaatttt
gatggcatgtacttgtcaatcgtgtctttcttatctgaaaagtttaatttaaaaagagtc
gggaaaatggaactagaatcaaaagaggattatgaagagaccactcatcataatgtggcg
tcctcagttgtcactgcaacccatgataacttagatggaagagagttttttgaactatgt
agtaatccagctctagttttttcgtttgagacacacaaaaaatttaatgagttacctgtt
gatagcaaggaatccccgttagatctttttatagctaatacaaagcaacttcacttgtta
agatctggtgatatttcaaacacattaagccatctgttgttattaggttatgtgtctgca
gccgaaagttatttgcgagctcttatcagaaatctaattaatcatgatgaatatatacag
tctatagtttctgataaggccgttagttatgcagcggcacaacaccataaaaaggagtta
ttaccagaagctttacttgaggacttttcattggcaagcccttataatgtttttgaaaca
ttaaaggacattattggaatgaaaggacaacgaccaatcgaaatgatgaaatgctcaagc
gaattcatgaaagtttgcgagttaaggcattgttgtgttcatcgatttggtaagttgggt
tcgaaaaatgcaatccgactaggattggctgaacatatgaagcacttagaaaaaccgata
atactcaataatgatgatctcgagcaaatcgcatttattgttgagaattttattagaact
ttgaataataccgttttcaaatttataattaatcgtacagttgagaacaaaaataaggaa
aaaggaggggaaagactatatgattctgaatggacatgggtgtttgaaaaagatataagt
cgatacgaaaagtattattcaatatttagtgccaaaaacgatacccttcccggattatca
ttacaggattcatatcaactttttgttaatgcatataagcctaaacttcctgcaagaaaa
aataaaaaaactgaagaaaattaa

DBGET integrated database retrieval system