KEGG   Escherichia coli O9 HS (commensal): EcHS_A0333
Entry
EcHS_A0333        CDS       T00591                                 

Definition
(GenBank) IS1, transposase orfB
  KO
K07480  insertion element IS1 protein InsB
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    EcHS_A0333
SSDB
Motif
Pfam: DDE_Tnp_IS1
Other DBs
NCBI-ProteinID: ABV04722
Position
complement(339443..339946)
AA seq 167 aa
MSRQCTHYGRWPQHGFTSLKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLF
YAYDRIRRTVVAHVFGERTLATLERLLSLLSAFEVVVWMTDGWPLYESRLKGKLHVISKR
YTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtcgcgccagtgcacgcattatgggcgttggcctcaacacggttttacgtcacttaaa
aaactcaggccgcagtcggtaacctcgcgcatacaaccgggcagtgatgtgattgtctgc
gctgaaatggacgaacagtggggctacgtcggtgctaaatcacgtcagcgctggctgttt
tacgcgtatgacaggatacggaggacggttgtggcgcacgtcttcggtgaacgcactctg
gccacactggagcgtcttctgagcctgctgtcggcctttgaggtcgtggtatggatgacg
gatggctggccgctgtatgaatcacgcctgaagggaaagctgcacgttatcagcaagcgt
tacactcagcgcattgagcgacataatctgaatctgagacaacatctggcaaggctggga
cggaagtcactgtcgttctcaaaatcggtggagctgcatgacaaggtcatcgggcattat
ctgaacataaaacactatcaataa

DBGET integrated database retrieval system