KEGG   Escherichia coli O9 HS (commensal): EcHS_A0335
Entry
EcHS_A0335        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: PDDEXK_4 HSDR_N NucS MmcB-like
Other DBs
NCBI-ProteinID: ABV04723
Position
complement(340169..340483)
AA seq 104 aa
MISDWEDSHRRIDLLAIDKQANIVVIELKRDETGTHMELQALRYAAMIYTMSFAKACEYF
QTYLKKQNRDADAKEKMRKKKYLNLLSWMKLSLLILGNAANLLI
NT seq 315 nt   +upstreamnt  +downstreamnt
gtgatttctgactgggaagatagccatcggcgaattgatttattggcaatcgataaacag
gcaaatatagtggttatcgaattaaaacgtgatgaaacggggacgcatatggagttacag
gcactacgatatgcggcaatgatttacacaatgagttttgcgaaagcatgtgagtatttt
cagacgtatttgaaaaaacaaaaccgcgatgccgatgcgaaagaaaaaatgcgaaagaaa
aaatacttgaatttgttgagctggatgaaactgagcttgttgattttgggtaatgctgcc
aacttactgatttag

DBGET integrated database retrieval system