KEGG   Escherichia coli O9 HS (commensal): EcHS_A0336
Entry
EcHS_A0336        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: DUF1819 Act-Frag_cataly
Other DBs
NCBI-ProteinID: ABV04724
Position
340859..341500
AA seq 213 aa
MRAAFQSSEGFSMIKNDKAWIGDLLGGPLMSRESRVIAELLLTDPDEQTWQEQIVGHNIL
QASSPNTAKRYAATIRLRLNTLDKSAWTLIAEGSERERQQLLFVALMLHSPVVKDFLAEV
VNDLRRQFKEKLPGNSWNEFVNSQVRLHPVLASYSDSSIAKMGNNLVKALAEAGYVDTPR
RRNLQAVYLLPETQAVLQRLGQQDLISILEGKR
NT seq 642 nt   +upstreamnt  +downstreamnt
ttgcgagctgcattccagtcttcagagggtttttcgatgattaaaaatgacaaggcatgg
ataggagacttgctgggcggaccgctcatgagcagggaaagccgcgtcattgccgaactg
ttgctaaccgatcccgatgaacagacatggcaagagcaaattgttggccacaacatttta
caagcctcttctcctaacaccgcaaaacgttacgcggcaacaatcaggcttcgcctgaac
acgctggataaaagcgcgtggacattgattgccgaaggtagtgaacgggaacgccaacaa
cttctgtttgtggctctgatgctacattcgccggtagttaaggattttctggctgaagtg
gtgaacgatctgcgcaggcagttcaaggaaaagttgcctggcaatagctggaacgaattt
gtgaatagccaggttcgcctacatccggtactcgccagctactcagattcatctattgca
aaaatgggaaacaatctggtgaaggcgcttgctgaagcgggttatgtggatacgccccgc
agacgtaacctgcaggcagtttaccttttaccggaaactcaggcagtgttacagcgcctg
ggacaacaggacttgatatctattctggagggaaaacggtga

DBGET integrated database retrieval system