KEGG   Escherichia coli O9 HS (commensal): EcHS_A0337
Entry
EcHS_A0337        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: DUF1788 DUF4279 CyRPA
Other DBs
NCBI-ProteinID: ABV04725
Position
341497..342099
AA seq 200 aa
MIDPVLEYRLSQIQSRINEDRFLKNNGSGNEIGFWIFDYPAQCELQVREHLKYLLRHLEK
DHKFACLNVFQIIIDMLNERGLFERVCQQEVKVGTETLKKQLAGPLNQKKIADFIAKKVD
LAAQDFVILTGMGNAWPLVRGHELMSALQDVMGFTPLLMFYPGTYSGYNLSPLTDTGSQN
YYRAFRLVPDTGPAATLNPQ
NT seq 603 nt   +upstreamnt  +downstreamnt
gtgatagatcccgttcttgaatatcgcctgtctcaaatccagagtcgcattaacgaagat
cgcttcctcaaaaataacggctccggaaatgaaattggtttttggatctttgattatccc
gcgcagtgcgaactgcaggtacgggagcatttgaaatatctgctccggcatctggaaaag
gaccataaatttgcctgtctgaatgtcttccaaatcatcatcgatatgctcaatgaacgc
ggccttttcgagcgcgtctgccagcaggaagtcaaagtgggtactgagacgctgaaaaag
cagcttgctggtccgttaaatcagaaaaagatcgctgattttatagcgaaaaaagtcgat
ctggctgcccaggattttgtcatccttaccggcatgggcaacgcctggccattagtacgc
ggtcatgaactgatgagtgccttgcaggatgtcatggggttcaccccactgctgatgttt
tatcctggcacctacagcgggtacaacctttccccgctcacagacaccggttcacaaaat
tattatcgcgctttcagactggtaccagatacgggacccgcagcaacattgaatcctcaa
tga

DBGET integrated database retrieval system