KEGG   Escherichia coli O9 HS (commensal): EcHS_A0338
Entry
EcHS_A0338        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: KAP_NTPase AAA_30 AAA_21 SpoVIF DUF4318 YgaB
Other DBs
NCBI-ProteinID: ABV04726
Position
342111..345752
AA seq 1213 aa
MNIEQIFKKPLKRNINGVVKAEQTDDASAYIELDEYVITRELENHLRHFFESYVPATGPE
RIRMENKIGVWVSGFFGSGKSHFIKILSYLLSNRKVTHNGTERNAYSFFEEKIKDALFLA
DINKAVHYPTEVILFNIDSRANVDDKEDAILKVFLKVFNERIGYCADFPHIAHLERELDK
RGQYETFKAAFADINGSRWEDERDAYYFISDDMAQALSQATQQSLEASRQWVEQLDKNFP
LDINNFCQWVKEWLDDNGKNILFMVDEVGQFIGKNTQMMLKLQTITENLGVICGGRAWVI
VTSQADINAAIGGMSSRDGQDFSKIQGRFSTRLQLSSSNTSEVIQKRLLVKTDEAKAALA
KVWQEKGDILRNQLAFDTTTTTALRPFTSEEEFVDNYPFVPWHYQILQKVFESIRTKGAA
GKQLAMGERSQLEAFQTAAQQISAQGLDSLVPFWRFYAAIESFLEPAVSRTITQACQNGI
LDEFDGNLLKTLFLIRYVETLKSTLDNLVTLSIDRIDADKVELRRRVEKSLNTLERLMLI
ARVEDKYVFLTNEEKEIENEIRNVDVDFSAINKKLASIIFDDILKSRKYRYPANKQDFDI
SRFLNGHPLDGAVLNDLVVKILTPKDPTYSFYNSDATCRPYTSEGDGCILIRLPEEGRTW
SDIDLVVQTEKFLKDNAGQRPEQATLLSEKARENSNREKLLRVQLESLLAEADVWAIGER
LPKKSSTPSNIVDEACRYVIENTFGKLKMLRPFNGDISREIHALLTVENDTELDLGNLEE
SNPDAMREVETWISMNIEYNKPVYLRDILNHFARRPYGWPEDEVKLLVARLACKGKFSFS
QQNNNVERKQAWELFNNSRRHSELRLHKVRRHDEAQVRKAAQTMADIAQQPFNEREEPAL
VEHIRQVFEEWKQELNVFRAKAEGGNNPGKNEIESGLRLLNAILNEKEDFALIEKVSSLK
DELLDFSEDREDLVDFYRKQFATWQKLGAALNGSFKSNRSALEKDAAAVKALGELESIWQ
MPEPYKHLNRITLLIEQVQNVNHQLVEQHRQHALERIDARIEESRQRLLEAHATSELQNS
VLLPMQKARKRAEVSQSIPEILAEQQETKALQMDADKKINLWIDELRKKQEAQLRAANEA
KRAAESEQTYVVVEKPVIQPVPKKTHLVNVASEMRNATGGEVLETTEQVEKALDTLRTTL
LAAIKAGDRIRLQ
NT seq 3642 nt   +upstreamnt  +downstreamnt
atgaatattgaacagatttttaaaaaacctctaaaacgaaatataaacggggtagtcaaa
gcagagcaaaccgatgatgccagcgcgtacatcgagttagatgaatatgtcatcacccgc
gaactggaaaaccatcttcgccatttcttcgaatcctatgttcctgccactggcccggaa
aggatccgtatggaaaacaagatcggcgtatgggtttcaggcttcttcggttcaggtaaa
tcgcactttattaagattctttcttatcttttatctaaccgcaaagttacacataacggt
acggaacgtaatgcttactccttctttgaagagaaaatcaaagatgcattattccttgcc
gatattaacaaagcggtgcattacccgactgaagtcattctgttcaatattgattcgcgt
gccaacgtagatgacaaagaagatgccattcttaaagtcttcctgaaagttttcaacgaa
cgcattggatactgcgctgattttccgcatattgcccatcttgagcgcgagctggataaa
cgcggtcagtatgaaacctttaaagccgcgtttgccgatatcaatggctcgcgctgggaa
gacgagcgcgacgcttactacttcatcagcgatgacatggcacaagcattaagccaggcc
acgcagcagagtcttgaagcctcccgccaatgggtggaacaactcgacaaaaacttcccg
ctggatatcaataatttttgccagtgggtaaaagagtggctggatgacaatggtaagaac
atcctctttatggtggatgaagtcggtcagttcattggcaaaaatacgcaaatgatgctg
aagctgcagactattactgaaaaccttggggtaatttgcggtggccgcgcatgggttatc
gtgacttcgcaggccgatatcaacgcggcaatcggtggtatgagcagtcgcgacggacag
gacttctccaagatccaggggcgcttctctacacgcctgcaactttccagctctaacaca
tcagaagttatccagaaacgtttgttggtaaagactgacgaagcaaaagcggcgctggca
aaagtgtggcaagagaaaggcgatatcctgcgtaaccagctggcttttgacactacaaca
actactgcactacgtccttttaccagcgaagaagagttcgttgacaactacccgtttgtc
ccgtggcactatcagattctgcaaaaagtgtttgaatctattcggacgaaaggtgcagcg
ggtaaacaattggccatgggtgagcgttctcagctggaggcattccagacggcggcgcag
caaatctcagcgcaagggctggattctctggtgcctttctggcgcttctatgccgccatt
gagagcttcctggaacctgccgttagccgcaccatcactcaggcttgccagaatggcatt
cttgatgagttcgatggcaacctgcttaaaacgctgttcctgatccgctatgtggaaacg
ctgaaaagcaccctggataacctggtcacattgtctatcgataggatcgatgccgataaa
gttgagttgcgccgccgggtcgaaaaaagtctcaacacgcttgaacgcctgatgctcatt
gcgcgcgttgaagataaatatgtgttcctgaccaacgaagaaaaagagatcgaaaacgag
atccgtaacgttgatgtcgatttctctgcgatcaacaaaaaactggcatcgatcatcttt
gatgacattctgaaaagccgtaaatatcgttatccggctaacaagcaagactttgatatc
agccgcttcctgaacgggcatccattagacggcgcagtgcttaacgatctggtggtgaag
atcctgacccctaaagatccgacttattcgttctataacagcgatgcgacctgtcgccct
tatacgtcagaaggcgacggctgtattttgattcgtctgcccgaagagggccgtacctgg
agcgatattgatttagtcgtccagactgaaaagttcctcaaagataacgccgggcaacgt
ccggaacaggctaccctgctctcagaaaaagcgcgtgaaaacagcaaccgggaaaaatta
ctccgtgttcagttggaatcactacttgcagaagcagatgtctgggcgattggcgagcgc
ttaccgaaaaaatcctccacgccatcgaacattgtcgatgaagcctgccgttacgtgatt
gaaaacaccttcggcaagctgaagatgctgcggccttttaacggcgacatctcccgtgaa
attcatgcattactgacggttgagaacgacaccgaactggatctcggtaacctcgaagag
tccaaccccgacgccatgcgcgaggtagaaacctggatcagcatgaatatcgaatacaat
aaaccggtgtatttacgcgatattctgaaccatttcgcgcgtcgcccttatggctggccc
gaagacgaagtgaaactgctggtagcccgtctggcctgcaaaggtaaattcagcttcagc
cagcaaaacaacaacgtcgaacgaaaacaggcgtgggaattatttaataacagccgccgc
catagcgaattgcgtctgcataaagttcgccgtcatgatgaagcgcaggtgcgtaaagcc
gcgcaaaccatggctgacatcgctcagcagccgtttaacgaacgggaagagccggcgctg
gttgaacatattcgtcaggtttttgaagagtggaagcaagagctgaacgtattccgcgcc
aaggcagagggcggaaacaatccggggaaaaacgagattgaatccggtctgcgcctgctt
aatgccattcttaatgagaaagaagattttgccctgatcgaaaaagtctcatcgctgaaa
gatgaacttctggatttcagcgaagaccgtgaagatttggtcgacttctaccgtaagcaa
ttcgccacctggcaaaaactgggtgctgcgctgaatggcagctttaaatctaaccgcagc
gcgctggaaaaagacgccgcagcggttaaagcgctgggcgagctggaaagcatctggcaa
atgccggaaccttataagcatctcaatcgcatcacgctgttgattgaacaggtccagaac
gtcaaccatcagttagtcgaacagcatcgccagcacgccctcgaacgcattgacgcccgc
atcgaggaaagccgtcaacgcttgctcgaagcgcacgccacgtcagaactgcaaaacagc
gttctgctgccgatgcaaaaagccagaaaacgcgctgaggtcagccagtctattccggaa
attttggcggaacagcaagagacaaaagcgctgcaaatggatgcagataaaaagattaac
ctgtggatcgacgagctgcgtaaaaagcaagaagcacaactccgggcagcaaatgaagcc
aaacgcgctgccgagtcagaacagacttatgttgtggtggaaaaacccgttatccaaccg
gtaccgaaaaaaacgcatctggtgaatgtcgccagtgagatgcgtaatgccaccggtggt
gaagttctagaaacgaccgaacaggtggaaaaggcgctcgacacgttacgcacaacgctg
ctggccgccattaaagcaggcgatcgcattcgccttcagtaa

DBGET integrated database retrieval system