KEGG   Escherichia coli O9 HS (commensal): EcHS_A0339
Entry
EcHS_A0339        CDS       T00591                                 

Definition
(GenBank) putative restriction enzyme
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: N6_Mtase Eco57I UPF0020 Methyltransf_31
Other DBs
NCBI-ProteinID: ABV04727
Position
345798..349415
AA seq 1205 aa
MNTNNIKKYAPQARNDFRDAVIQKLTTLGIAADKKGNLQIAEAETIGETVRYGQFDYPLS
TLPRRERLVKRAREQGFEVLVEHCAYTWFNRLCAIRYMELHGYLDHGFRMLSHPETPTAF
EVLDHVPEVAEALLPESKAQLVEMKLSGNQDEALYRELLLGQCHALHHAMPFLFEAVDDE
AELLLPDNLTRTDSILRGLVDDIPEEDWEQVEVIGWLYQFYISEKKDAVIGKVVKSEDIP
AATQLFTPNWIVQYLVQNSVGRQWLQTYPDSPLKDKMEYYIEPAEQTPEVQAQLAAITPA
SIEPESIKVLDPACGSGHILTEAYNVLKAIYEERGYRTRDIPQLILENNIFGLDIDDRAA
QLSGFAMLMLARQDDRRILGRGVRLNIVSLQESKLDIAEVWTKLNFHQHMQRGSMGDMFT
QGTALANTDSAEYKLLMRTLALFTSAKTLGSLIQVPQEDEAALKAFLERLYRLAVEGDIQ
QKEAAAELIPYIQQAWILAQRYDAVVANPPYMGGKGMNGDLKEFAKKQFPDSKSDLFAMF
MQHAFSLLKENGFNAQVNMQSWMFLSSYEALRGWLLDNKTFITMAHLGARAFGQISGEVV
QTTAWVIKNNHSGFYKPVFFRLVDDNEEHKKNNLLNRMNCFKNTLQNDFKKIPGSPIAYW
ATLAFINSFLKLPALGTRAVKGLDTNGSIDVFLRRWPEVSINSFDALGKGNSKWFPIAKG
GELRKWFGNHEYIINYENDGIELRKNKANLRNKDMYFQEGGTWTVVSTTGFSMRYMPKGF
LFDQGGSAVFCENNDELSIYNILACMNSKYINYSASLICPTLNFTTGDVRKFPVIKNNHL
EDLAKKAIEISKADWNQFETSWEFSKNKLIEHKGNVAYSYASYCNFQDKLYEQLVNIEKN
INNIIEEILGFKIETTENSELITLNSNKIYRYGQSETNDTFLNRHRSDTISELISYSVGC
QMGRYSLDREGLVYAHEGNKGFAELAAEGAYKTFPADNDGILPLMDDEWFEDDVTSRVKE
FVRTVWGEEHLQENLEFIAESLCLYAIKPKKGESALETIRRYLSTQFWKDHMKMYKKRPI
YWLFSSGKEKAFECLVYLHRYNDATLSRMRTEYVVPLLARYQANIDRLNDQLDEASGGEA
TRLKRERDSLIKKFSELRSYDDRLRHYADMRISIDLDDGVKVNYGKFGDLLADVKAITGN
APEAI
NT seq 3618 nt   +upstreamnt  +downstreamnt
atgaataccaataacattaaaaaatatgccccacaggcccgtaacgacttccgcgatgcg
gtgatccagaagctaacgacgcttgggatcgctgcagataaaaaaggcaatttgcagatt
gccgaggccgaaaccattggcgagaccgtgcgttacggtcagtttgattacccgttatcg
acccttccccgccgcgaacggctggtaaaacgcgcccgtgagcagggttttgaggtgctg
gttgagcactgcgcctacacctggtttaaccgcttatgtgcaattcgctatatggagctg
cacggttatcttgatcacggcttccgtatgttgtctcacccggagactccgaccgcgttt
gaggtgctggatcatgtgccggaagtggcagaagctctgctaccagaaagtaaggcgcag
ttggttgaaatgaagctttccggtaatcaggacgaagctctgtaccgtgaactgctgctg
gggcagtgccacgccctgcaccacgcgatgccgttcctgtttgaagcggtagatgacgaa
gcggaactgctgctgccggataacctgacccgtactgactccattctacgtgggctggtt
gatgatattccggaagaagactgggagcaggtagaggttatcggctggctgtatcagttc
tatatttcggaaaagaaagatgccgtgattggcaaagtggtgaagagcgaagatattcct
gccgccacccagctgtttacgccgaactggattgtgcagtatctggtacagaactccgtt
ggccgccagtggttgcagacctacccggactcaccgctgaaagacaaaatggagtactac
attgagcctgcggagcaaacgccggaagtgcaggcgcagctggcggcgattaccccggcc
agcattgagcctgaaagcattaaagtgctggatccggcctgcggttccgggcatatcctg
acagaagcctataacgtgctgaaggccatttacgaagagcgcggttaccgtacccgtgac
attccgcagctgattctggaaaacaatattttcggcctggacatcgatgatcgtgcggcg
cagctttccggatttgcgatgctgatgctggcacgccaggatgaccgtcgtattctgggc
cgtggtgtgaggctgaatattgtctccctacaggaaagtaagctggatattgctgaggtt
tggaccaagctgaacttccatcagcatatgcaacgcggcagcatgggagatatgtttacc
caagggacggcactggccaataccgacagcgcggaatataagctactgatgcgtactctg
gcattgttcactagtgcaaaaacgctgggatcactgattcaggtaccgcaggaagacgaa
gcggcgttgaaagcgtttctggagagattgtatcgtctggctgttgaaggtgatattcag
cagaaagaggctgcggcagagctgatcccatatattcagcaggcgtggatactggcgcaa
cgttatgatgctgtggtcgcgaacccgccgtatatgggggggaaagggatgaatggtgat
ctgaaagagtttgctaaaaaacaattcccggacagcaagtcggatttgtttgcgatgttt
atgcaacatgcattttctttactcaaagaaaacggttttaatgcgcaagtgaatatgcag
tcatggatgttcctgtctagctatgaagcgcttcgtggatggttgctggataataaaacc
tttattacgatggcacatttgggggctcgagcatttggtcaaatctctggagaagttgtt
caaactaccgcatgggtgattaaaaataaccattcaggattttataaacctgtatttttc
cgtttagttgacgataatgaagaacataaaaaaaacaatctcttgaatcggatgaattgc
tttaaaaacactctgcagaatgactttaaaaaaatacctggttcacccattgcttactgg
gcaacattggcgtttattaattcctttcttaaattgcctgctcttggaactcgtgctgtg
aaaggactagatacaaacgggtccattgatgtatttttgcgcagatggccggaagtcagc
ataaattcctttgatgcattagggaaaggtaactcaaaatggtttccgattgcaaaaggg
ggtgagttgaggaagtggttcggaaatcatgagtatatcataaactatgaaaatgatggc
attgaattaagaaaaaacaaagcaaacttgagaaataaggatatgtactttcaggagggg
ggaacctggactgttgtatcaaccaccggtttctcaatgagatatatgccaaaaggattc
ctttttgaccaaggcggttctgctgttttttgtgaaaataatgatgagctatcgatatat
aacatcctggcctgcatgaactctaaatatatcaactactctgcaagtttaatttgtcct
acgcttaactttacaaccggtgatgttaggaaattccctgttataaaaaacaatcacctt
gaagatttagcaaaaaaagcaattgagatatcaaaagcagactggaaccaattcgagaca
tcttgggagttcagtaaaaacaagttaattgaacacaaaggaaacgttgcttattcgtat
gctagctattgtaactttcaagataaactgtatgaacagctagttaatattgaaaaaaat
attaataacataatcgaagaaatactgggttttaaaatagaaacaacagagaatagtgag
ttaattacattaaactcgaacaaaatatatcgttatgggcaaagtgaaaccaatgataca
ttcctaaacaggcatcggagtgacaccatttcggaactcatctcatattcagtcggctgc
caaatgggacgctattccctcgatcgcgaaggcctcgtctacgcccatgaaggcaacaaa
ggctttgccgaacttgccgctgaaggtgcgtacaaaaccttcccggcagacaatgacggc
atcctgccgctgatggatgacgagtggtttgaggacgacgtcacctctcgcgtcaaagag
tttgtccgcaccgtctggggcgaagagcacctgcaggaaaacctcgaatttatcgccgaa
agtctctgtttatacgcgatcaagccgaaaaaaggcgaatctgcgctggagaccattcgt
cgctatctttccacacagttctggaaagatcatatgaagatgtataaaaagcgcccaatc
tactggctattcagctccggtaaagagaaagccttcgagtgcctggtgtatctgcatcgc
tataacgacgccacgctgtcgagaatgcgtaccgaatatgtggtgccgctgctggcacgt
tatcaggccaatatcgatcgcctgaacgatcaacttgatgaagcttctggcggtgaagcc
acacgcctgaaacgcgaacgcgacagcctgatcaaaaaatttagcgaactgcgtagctat
gacgaccgcctgcgtcactatgctgatatgagaatcagtattgatctcgacgatggcgtt
aaggttaactacggcaagtttggcgatctgctggcagatgtcaaagccatcaccggcaat
gccccagaggcgatctaa

DBGET integrated database retrieval system