KEGG   Escherichia coli O9 HS (commensal): EcHS_A0340
Entry
EcHS_A0340        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: PglZ Metalloenzyme
Other DBs
NCBI-ProteinID: ABV04728
Position
349592..352189
AA seq 865 aa
MQNQDFIAGLKAKFAEHRIVFWHDPDKRFIEELEQLKLENVTLINMTHASQLAVKKRIEM
DEPEQQFLLWFPHDAPPHEQDWLLDIRLYSSEFHADFAAITLNTLGIPQLGLREHIQRRK
AFFSTKRTQALKNLVTEQEDETSLDKKMIAVIAGAKTAKTEDILFNLITQYVNQQTEDDS
ELENTQAMLKRHGLDPVLWEMLNHEMGYQAEEPSLENLLLKLFCTDLSAQADRQQRAWLE
KNVLLTPSGRASALAFMVTWRADRRYKEAYDYCAQQMQAALRPEDHYRLSSPYDLHECET
TLSIEQTIIHALVTQLLEESTTLDREAFKKLLSERQSKYWCQTQPEYYAIYDALRQAERL
LNLRNRHIDGFHYQDSATFWKAYCEELFRFDQAYRLFNEYALLVHSKGAMILKSLDDYIE
ALYSNWYLAELSRNWNEVLEAENRMQAWQIPGVPRQKNFFNEVVKPQFQNPQIKRVFVII
SDALRYEVAEELGNQINTEKRFTAELRSQLGVLPSYTQLGMAALLPHEQLCYQPSNGDIV
YADGLSTSGIPNRDTILKNYKGMAIKSKDLLELKNQEGRDLIRDYEVVYIWHNTIDATGD
TASTEDKTFEACRTAVTELKDLVTKVINRLHGTRIFVTADHGFLFQQQALSVQDKTTLQI
KPENTIKNHKRFIIGHQLPADDFCWKGKVADTAGVSDNSEFLIPKGIQRFHFSGGARFVH
GGTMLQEVCVPVLQIKALQKTAAEKQPQRRPVDIVAYHPMIKLVNNIDKVSLLQTHPVGE
LYEPRILNIYIVDNANNVVSGKERISFDSDNSTMEKRVREVTLKLIGANFNRRNEYWLIL
EDAQTETGYQKYPVIIDLAFQDDFF
NT seq 2598 nt   +upstreamnt  +downstreamnt
ttgcaaaatcaggactttattgctggccttaaagctaaatttgccgaacatcgcatcgtt
ttctggcacgatcccgataaacgttttattgaggaactggaacagctcaagcttgaaaac
gtcacgctaatcaacatgacccacgcgtcacagctggcggtgaaaaaacgcatcgagatg
gatgagccagaacagcagttcctgctgtggttcccccatgatgcgccgcctcatgaacaa
gactggctgctggatatccgcctttacagcagcgaattccatgccgattttgccgccatc
accctgaacacgctgggcattccccagcttggcctgcgcgagcatattcagcgacgcaag
gccttcttcagcactaaacgtacgcaggcgctgaaaaacctggtgacggaacaggaagat
gaaacctcgctggataagaaaatgattgcggtgatcgctggcgcaaagaccgcgaaaacc
gaagacattttgtttaacctgattacccagtacgttaaccaacaaacagaagacgacagc
gaactggaaaacacgcaggcgatgttgaaacgccacggtctggacccggtattgtgggaa
atgctcaaccacgaaatgggctaccaggcagaggagccatcgctggaaaacctgctcctg
aaactgttttgtaccgatctctctgcccaggccgacagacagcagcgcgcctggctggaa
aaaaatgtcctgctgacgccatccggcagagcatccgccctggcatttatggtgacctgg
cgtgccgatcgtcgctataaagaggcttatgactactgcgctcagcaaatgcaggcggcc
ctgcgcccggaagatcattaccgactcagttcgccgtatgatttgcacgaatgcgaaacc
accctcagcatcgaacaaaccattattcatgcgctggtaacgcaactgctggaagagagc
accacgctcgatcgggaagcctttaaaaaactgctctctgaacgccagagcaaatactgg
tgccagacacaaccagagtattacgccatctatgacgcgctgcgccaggctgagcgtttg
ctgaatctgcgcaatcgccacatcgatggtttccactaccaggacagcgccaccttctgg
aaagcctactgcgaagaactgttccgcttcgaccaggcttatcgcctgtttaatgaatat
gccctgctggttcacagcaaaggggcgatgatcctcaagagcctggatgattatatcgag
gcgctctacagcaactggtatctggcagaattaagccgtaactggaacgaagtgctggaa
gcggaaaatcgtatgcaggcgtggcaaatccccggcgtgccgcgtcagaagaactttttc
aatgaggtggtgaagccgcagttccaaaatccgcaaatcaaacgcgtgttcgtgataatt
tccgatgccctgcgttatgaagtggcggaggagctggggaatcaaatcaataccgagaaa
cgctttaccgcagaactgcgctcgcagctcggcgtgctccccagctacacccaactggga
atggcggcattgctgccccatgaacaactttgctatcaaccaagtaacggcgacatcgtt
tatgctgatgggctgtcgacctcgggtattcctaaccgcgataccattctgaagaactat
aagggaatggcgataaaatcgaaggaccttctggagttaaaaaatcaggaagggcgggac
cttattcgcgattacgaagtggtgtatatctggcataacacgattgatgccaccggtgac
acggcatccacggaagataaaaccttcgaagcgtgccgcacggcggtgactgaactgaaa
gatttagtcaccaaggtaatcaaccgtctccacggcacacgcatttttgttacggcggat
cacggtttcctgttccagcaacaggcgctttcggttcaggataaaaccactctgcaaatt
aagccggaaaacaccatcaagaaccacaaacgctttattatcggccatcagcttcccgcc
gatgatttttgctggaaaggaaaggtggcggataccgcaggcgtgagcgacaacagcgag
ttccttattccgaaagggatccagcgcttccatttctctggcggcgcgcgcttcgttcat
ggcggcaccatgttgcaggaggtttgcgttccggtattgcagataaaagccctgcaaaaa
accgccgcagaaaaacagccgcagcgccgcccggtggatattgtcgcttaccatcccatg
attaagctggtgaacaatatcgataaagtgagcctgttgcagacgcatccggtgggcgaa
ctttatgaaccgcgtatcctgaacatttacattgtcgataacgccaacaatgtggtctcg
ggcaaagagcgcatcagctttgacagcgataacagcaccatggaaaaacgcgtacgcgaa
gttacgctgaagctgattggcgctaacttcaaccgtcgcaatgagtactggttgatactg
gaagacgcacaaacggaaacggggtatcagaagtacccggtcattatcgatctggcgttc
caggatgatttcttctaa

DBGET integrated database retrieval system