KEGG   Escherichia coli O9 HS (commensal): EcHS_A0341
Entry
EcHS_A0341        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01338  ATP-dependent Lon protease [EC:3.4.21.53]
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecx01002]
    EcHS_A0341
Enzymes [BR:ecx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     EcHS_A0341
Peptidases and inhibitors [BR:ecx01002]
 Serine peptidases
  Family S16: lon protease family
   EcHS_A0341
SSDB
Motif
Pfam: Lon_2 Lon_C ChlI
Other DBs
NCBI-ProteinID: ABV04729
Position
352200..354284
AA seq 694 aa
MQTHHDLPVSGVSAGEIASEGYDLDALLNQHFAGRVVRKDLTKQLKEGANVPVYVLEYLL
GMYCASDDDDVVEQGLQNVKRILADNYVRPDEAEKVKSLIRERGSYKIIDKVSVKLNQKK
DVYEAQLSNLGIKDALVPSQMVKDNEKLLTGGIWCMITVNYFFEEGQKTSPFSLMTLKPI
QMPNMDMEEVFDARKHFNRDQWIDVLLRSVGMEPANIEQRTKWHLITRMIPFVENNYNVC
ELGPRGTGKSHVYKECSPNSLLVSGGQTTVANLFYNMASRQIGLVGMWDVVAFDEVAGIT
FKDKDGVQIMKDYMASGSFSRGRDSIEGKASMVFVGNINQSVETLVKTSHLLAPFPAAMI
DTAFFDRFHAYIPGWEIPKMRPEFFTNRYGLITDYLAEYMREMRKRSFSDAIDKFFKLGN
NLNQRDVIAVRRTVSGLLKLMHPDGAYSKEDVRVCLTYAMEVRRRVKEQLKKLGGLEFFD
VNFSYIDNETLEEFFVSVPEQGGSELIPAGMPKPGVVHLVTQAESGMTGLYRFETQMTAG
NGKHSVSGLGSNTSAKEAIRVGFDYFKGNLNRVSAAAKFSDHEYHLHVVELHNTGPSTAT
SLAALIALCSILLAKPVQEQMVVLGSMTLGGVINPVQDLAASLQLAFDSGAKRVLLPMSS
AMDIPTVPAELFTKFQVSFYSDPVDAVYKALGVN
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgcaaacccatcatgatttacctgtttcaggcgtatccgcaggggaaattgcctccgag
ggttacgatctggacgccctgctgaaccagcattttgctggtcgtgtggtgcgtaaagat
ctcaccaagcaactcaaggaaggggcaaacgtcccggtgtatgtgctggagtatctgctc
ggcatgtactgcgcctctgacgatgacgacgtggtcgagcaagggttgcaaaacgttaag
cgtattctggctgataactatgtgcgcccggatgaagcagagaaagtgaagtcgctgatc
cgcgagcgtggttcgtacaaaatcatcgataaagtgtcggtgaagctaaaccagaaaaaa
gacgtttacgaagcccagctttctaacctcggcatcaaagacgcgctggtgccatcgcag
atggttaaagacaacgagaagctactaacgggcggtatctggtgcatgattaccgtcaac
tatttctttgaagaagggcagaagacttcgcccttctcattgatgacgcttaagcctatc
cagatgccgaatatggatatggaagaagtgttcgatgcgcgtaaacactttaaccgtgat
cagtggatcgatgtgctgctgcgctcagtgggtatggagcccgccaatattgagcaacgc
accaaatggcaccttatcacccgtatgatcccgttcgtggagaacaactataacgtttgc
gagctggggccgcgtggcaccggtaaaagccatgtgtataaagagtgttctcctaactct
ctgttagtttctggcgggcaaacgaccgttgccaacttgttctacaacatggccagtcgc
cagatcggcctggttggcatgtgggatgtggtagcgttcgacgaagtcgcggggatcact
ttcaaagataaagacggcgtgcaaatcatgaaagattacatggcgtcaggatctttctct
cgcggcagagattcgattgaaggtaaagcgtcgatggttttcgtcggcaacatcaatcaa
agcgtagagactctcgttaaaaccagccatttgctggcgccatttccggctgcgatgatt
gatactgcatttttcgaccgctttcatgcctatattcccggttgggaaatccccaaaatg
cgcccggaattttttaccaaccgttacgggctgattacggattatctcgctgaatatatg
cgcgaaatgcgcaaacgcagtttctctgatgcgattgataaattctttaagctgggtaac
aacctcaaccagcgtgacgttattgccgttcgacgtaccgtgtcggggttgttaaaactc
atgcatcccgatggcgcgtacagcaaagaagatgtgcgagtctgcctgacctatgcgatg
gaagttcgtcgccgcgtgaaagagcaacttaaaaaactgggcggtctggagttcttcgat
gtgaactttagctacatcgacaacgaaacgctggaagagttttttgtgagcgtaccggaa
cagggcggcagcgaacttattcctgccggaatgccaaagccgggtgttgtgcatctggtc
actcaggcagaaagcggcatgaccgggctgtatcgttttgaaacacagatgactgccggt
aatggtaagcatagtgtatcgggtctgggttcaaatacctccgcgaaagaagctatccgc
gtcggtttcgattacttcaaaggcaatttgaatcgggtaagcgcggccgcgaaattctcc
gatcatgaatatcaccttcatgtcgttgaactgcataatactggcccaagcaccgcaacc
agtcttgctgcgcttatcgctttatgttcgatattgctggcaaaaccggtgcaggaacag
atggtggtgttgggcagtatgacgcttggtggggtaattaacccggtgcaggatcttgcc
gccagtttacagctcgccttcgacagcggtgcaaaacgggttctgttgccgatgtcctcg
gctatggatattccaacggttccggcagagttatttaccaagtttcaggtgagtttttac
tcagacccggttgatgctgtttataaggcgctgggtgtgaattaa

DBGET integrated database retrieval system