KEGG   Escherichia coli O9 HS (commensal): EcHS_A0343
Entry
EcHS_A0343        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: zinc_ribbon_11 zinc-ribbons_6 HypA NCD3G
Other DBs
NCBI-ProteinID: ABV04731
Position
complement(354971..355354)
AA seq 127 aa
MYAKSFLALDGNGRLTGARTAQTAPYDSYTCHLCGSALRYHPQYDTERPWFEHADEGLTE
HGHECPYVRPERREIRLIKRLQQFVPDALPVVRKASWHCRQCHHDYYGEQYCTHCQTGRF
SEEGGAE
NT seq 384 nt   +upstreamnt  +downstreamnt
atgtacgcaaaatcttttctcgcacttgatggcaacggacgtctgaccggtgcccgtacc
gcacagactgcaccttacgatagctacacctgccacctttgcggcagtgcactcagatac
cacccgcaatacgataccgaacgtccctggtttgaacacgctgacgaagggctgacggag
cacggtcatgagtgcccttatgtcaggccggaacgcagagaaatacggttgattaaacgt
ctgcagcaattcgtcccggatgccttacccgtagtacgtaaagccagctggcactgcagg
caatgtcaccacgattattatggggagcagtactgcacacactgccagaccgggcgcttc
agtgaggaggggggagcagaatga

DBGET integrated database retrieval system