KEGG   Escherichia coli O9 HS (commensal): EcHS_A0344
Entry
EcHS_A0344        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-ProteinID: ABV04732
Position
complement(355623..355739)
AA seq 38 aa
MLWCKPLNDKYGLALIFAVGSGGHFSGTAHFLRRGHSV
NT seq 117 nt   +upstreamnt  +downstreamnt
gtgctctggtgtaaacccctgaacgacaagtacgggctggcgctaatctttgctgtcggt
tccggcggccacttcagcggcactgcgcattttttacggcgtggtcattccgtatga

DBGET integrated database retrieval system