KEGG   Escherichia coli O9 HS (commensal): EcHS_A0345
Entry
EcHS_A0345        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Inovirus_Gp2
Other DBs
NCBI-ProteinID: ABV04733
Position
complement(355726..356325)
AA seq 199 aa
MQTYNTNPAYEMAPQLLEHFNQHLDSLFGVYSKLLPFRMDFAYRKNTLSYRCACRYAMCA
EMLQLINEVGEKLVGYAWVMEYTERKGLHIHFVGYLNGQSHRSSYLVSRLMGDIWRRVTE
GNGYYHWCRFNKNYPVNINHVIHYSDHKAVNDLRYAISYLAKREQKECGIILKCSGLPEK
SNRGRPRLDSPLPGICALV
NT seq 600 nt   +upstreamnt  +downstreamnt
atgcaaacttataacaccaatcccgcttacgaaatggctccccagctcctggagcacttt
aaccagcatctggattcattattcggggtctattcgaaactgttaccgttcagaatggat
tttgcttaccgaaaaaacaccctcagctacagatgtgcctgcaggtacgccatgtgcgcg
gagatgctgcaactgattaacgaggtgggagagaaactggtcgggtatgcctgggtgatg
gaatatacagaacgtaaagggcttcacattcattttgtgggctatctgaacggccagagc
cacaggagttcgtatctggtatccagattgatgggagatatctggaggcgggttaccgag
ggtaatggttactaccactggtgccggtttaataaaaattatccggtaaacattaaccac
gtcattcactattcagatcacaaagcggtgaatgatttacgctatgccatcagctacctg
gccaaacgggaacagaaagaatgtggcatcatcctgaaatgcagcgggcttcctgaaaaa
agtaaccggggtcgaccacgactggacagccccctgccggggatatgtgctctggtgtaa

DBGET integrated database retrieval system