KEGG   Escherichia coli O9 HS (commensal): EcHS_A0347
Entry
EcHS_A0347        CDS       T00591                                 

Definition
(GenBank) ISEhe3, transposase orfB
  KO
K07497  putative transposase
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    EcHS_A0347
SSDB
Motif
Pfam: rve rve_2 HTH_21 rve_3 DDE_Tnp_IS240 HTH_33 Adeno_E1B_19K
Other DBs
NCBI-ProteinID: ABV04735
Position
357214..358026
AA seq 270 aa
MLDVHPSGFYAWLQQPHSQRHQADLRLTGQIKQFWLESGCVYGYRKIHLDLRDSGQQCGV
NRVWRLMKRVGIKAQVGYRSPRARKGEASIVSPNRLQRQFNPDAPDERWVTDITYIRTHE
GWLYLAVVVDLFSRKIIGWSMQSRMTKDIVLNALLMAVWRRNPEKQVLVHSDQGSQYTSH
EWQSFLKSHGLEGSMSRRGNCHDNAVAESFFQLLKRERIKKKIYGTREEARSDIFDYIEM
FYNSKRRHGSSEQMSPTEYENQYYQRLGSV
NT seq 813 nt   +upstreamnt  +downstreamnt
gtgctggatgttcatcccagtggtttttacgcctggcttcagcagccgcattcacaacgc
catcaggcagacctgagactgacaggacagattaaacagttctggctggaatcgggatgc
gtctatggttatcgcaaaatccatctggatttgcgtgacagcgggcaacagtgcggagta
aacagagtctggagactgatgaaacgtgtcggaataaaggctcaggtcggataccgaagc
ccgcgggcacgtaaaggcgaggccagtatcgtgtcacccaacaggctccagcgacagttc
aatccggatgctcctgatgagcgttgggtaacggacataacctacatcaggacccacgaa
ggctggctgtatcttgccgttgttgttgatctgttctcacgcaaaattatcggctggtcc
atgcaatcccggatgacaaaggacattgtcctgaacgcactgctgatggctgtatggcgg
cgtaatcccgaaaaacaggtgctggttcattcggatcagggcagtcagtacacaagccat
gagtggcagtcgttcctgaaatcacacggcctggagggtagcatgagccgtcgcggtaac
tgccatgataatgcggttgcagaaagttttttccagttgttgaaacgtgaacggataaag
aaaaagatctacggaacgcgggaagaagcccgcagtgatatttttgattacatcgaaatg
ttttataacagtaagcgtcggcatggttctagcgaacagatgtcaccgacagaatatgaa
aaccagtattatcaacggctcggaagtgtctag

DBGET integrated database retrieval system