KEGG   Escherichia coli O9 HS (commensal): EcHS_A0348
Entry
EcHS_A0348        CDS       T00591                                 

Gene name
matA
Definition
(GenBank) fimbrillin MatA
  KO
K21963  LuxR family transcriptional regulator, Mat/Ecp fimbriae transcriptional regulator
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecx03000]
    EcHS_A0348 (matA)
Transcription factors [BR:ecx03000]
 Prokaryotic type
  Helix-turn-helix
   LuxR family
    EcHS_A0348 (matA)
SSDB
Motif
Pfam: GerE Sigma70_r4_2 HTH_7 HTH_23 HTH_28 HTH_29
Other DBs
NCBI-ProteinID: ABV04736
UniProt: A7ZWT2
Position
complement(358203..358793)
AA seq 196 aa
MTWQSDYSRDYEVKNHMECQNRSDKYIWSPHDAYFYKGLSELIVDIDRLIYLSLEKIRKD
FVFINLNTDSLSEFINRDNEWLSAVKGKQVVLIAARKSEALANYWYYNSNIRGVVYAGLS
RDIRKELAYVINGRFLRKDIKKDKITDREMEIIRMTAQGMQPKSIARIENCSVKTVYTHR
RNAEAKLYSKIYKLVQ
NT seq 591 nt   +upstreamnt  +downstreamnt
gtgacatggcaaagtgattacagcagggactatgaggttaaaaaccatatggaatgtcaa
aaccgttctgataaatacatctggtctccccatgacgcctacttctataaaggactatct
gaactgattgtggatatcgacagattaatttatctatcgttggagaaaattagaaaagat
ttcgtgtttatcaatctcaatacggattctttatctgaatttataaaccgtgataatgaa
tggttatccgcggtaaaggggaaacaggtcgtattgattgcggccagaaagtcagaagcc
ttagcaaattattggtattacaacagcaatattaggggcgtggtatacgctggactgagt
cgtgatattagaaaagaactggcctatgtgattaatggcaggttcctgagaaaagatatt
aagaaagataaaatcacggaccgggaaatggaaattatccgcatgacggcccagggaatg
caacctaaatcgattgccagaattgaaaattgtagtgtgaagacagtgtatacccatcgg
cgtaatgctgaggccaagctgtactcaaaaatatataagttggttcagtaa

DBGET integrated database retrieval system