KEGG   Escherichia coli O9 HS (commensal): EcHS_A0349
Entry
EcHS_A0349        CDS       T00591                                 

Gene name
rpmJ2
Definition
(GenBank) ribosomal protein L36
  KO
K02919  large subunit ribosomal protein L36
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EcHS_A0349 (rpmJ2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ecx03011]
    EcHS_A0349 (rpmJ2)
Ribosome [BR:ecx03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EcHS_A0349 (rpmJ2)
  Bacteria
    EcHS_A0349 (rpmJ2)
SSDB
Motif
Pfam: Ribosomal_L36
Other DBs
NCBI-ProteinID: ABV04737
UniProt: A7ZWT3
Position
complement(359830..359970)
AA seq 46 aa
MKVLNSLRTAKERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKKR
NT seq 141 nt   +upstreamnt  +downstreamnt
atgaaagttcttaactctctgcgtaccgcaaaagaacgccatccagactgtcagattgtg
aagcgaaaaggacggttgtatgtgatttgtaaatctaatccacgttttaaggccgttcag
ggtcgtaagaaaaaacgttga

DBGET integrated database retrieval system