KEGG   Escherichia coli O9 HS (commensal): EcHS_A0350
Entry
EcHS_A0350        CDS       T00591                                 

Gene name
rpmE2
Definition
(GenBank) ribosomal protein L31
  KO
K02909  large subunit ribosomal protein L31
Organism
ecx  Escherichia coli O9 HS (commensal)
Pathway
ecx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EcHS_A0350 (rpmE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ecx03011]
    EcHS_A0350 (rpmE2)
Ribosome [BR:ecx03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    EcHS_A0350 (rpmE2)
SSDB
Motif
Pfam: Ribosomal_L31
Other DBs
NCBI-ProteinID: ABV04738
UniProt: A7ZWT4
Position
complement(359970..360233)
AA seq 87 aa
MKPNIHPEYRTVVFHDTSIDEYFKIGSTIKTDREIELDGVTYPYVTIDVSSKSHPFYTGK
LRTVASEGNVARFTQRFGRFVSTKKGA
NT seq 264 nt   +upstreamnt  +downstreamnt
atgaagcccaatatccatcctgagtatcgtactgtggtgttccacgacaccagtattgat
gagtactttaaaatcggctcgactatcaaaacagaccgtgagattgagctggatggcgta
acgtatccatacgtaacaattgatgtctcttcgaaatcgcacccgttctatacagggaag
ctgagaacagtggcatcagaaggaaatgttgcacggttcacccaacgttttggtcgtttt
gttagcacgaaaaagggggcgtga

DBGET integrated database retrieval system