KEGG   Escherichia coli O9 HS (commensal): EcHS_A0351
Entry
EcHS_A0351        CDS       T00591                                 

Definition
(GenBank) putative intimin
  KO
K13735  adhesin/invasin
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: IAT_beta Invasin_D3 Big_1 Filamin Glyco_hydro2_C5 CarboxypepD_reg Big_3_5 MG4 ZirS_C CcmH
Other DBs
NCBI-ProteinID: ABV04739
Position
361814..366067
AA seq 1417 aa
MSRYKTDHKQPRFRYSVLARCVAWANISVQVLFPLAVTFTPVMAARAQHAVQPRLSMGNT
TVTADNNVEKNVASFAANAGTFLSSQPDSDATRNFITGMATAKANQEIQEWLGKYGTARV
KLNVDKDFSLKDSSLEMLYPIYDTPTNMLFTQGAIHRTDDRTQSNIGFGWRHFSGNDWMA
GVNTFIDHDLSRSHTRIGVGAEYWRDYLKLSANGYIRASGWKKSPDIEDYQERPANGWDI
RAEGYLPAWPQLGASLMYEQYYGDEVGLFGKDKRQKDPHAISAEVTYTPVPLLTLSAGHK
QGKSGENDTRFGLEVNYRIGEPLEKQLDTDSIRERRMLAGSRYDLVERNNNIVLEYRKSE
VIRIALPERIEGKGGQTLSLGLVVSKATHGLKNVQWEAPSLLAEGGKITGQGSQWQVTLP
AYRPGKDNYYAISAVAYDNKGNASKRVQTEVVITGAGMSADRTALTLDGQSRIQMLANGN
EQRPLVLSLRDAEGQPVTGMKDQIKTELTFKPAGNIVTRTLKATKSQAKPTLGEFTETEA
GVYQSVFTTGTQSGEATITVSVDGMSKTVTAELRATMMDVANSTLSANEPSGDVVADGQQ
AYTLTLTAVDTDGNPVTGEASRLRFVPQDTNGVTIGTISEIKPGVYSATVSSTRAGNVVV
RAFSEQYQLGTLQQTLKFVAGPLDAAHSSITLNPDKPVVGGTVTAIWTAKDANDNPVTGL
NPDAPSLSGAAAAGSTASGWTDNGDGTWTAQISLGTTAGELEVIPKLNGQDAAANAAKVT
VVADALSSNQSKVSVAEDHVKAGESTTVTLIAKDAHGNAISGLSLSASLTGAASEGATVS
GWTEKGDGSYVATLTTGGKTGELLVMPLFNGQPAATEAAQLTVIAGEMSSANSTLVADNK
APTVKTTTKLTFTVKDAYGNLVTGLKPDAPQFSGAASTGTERPSTGDWTETSNGVYVATL
TLGSAAGQLSVMPRVNGQNAVAQPLVLNVAGDASKAEIRDMTVKVDNQLANGQSTNQVTL
TVVDTYGNPLQGQNVTLTLPKGVTSKTGNTVTTDAAGKADIELMSTVAGEHSITASVNNA
QKTVTVKFKADFSTGQASLEVDSAAPKVANGKDAFTLTATVEDKNGNPVPGSLVTFNLPR
GVKPLTGDNVWVKANDEGKAELQVVSVTAGTYEITASAGNSQPSDTQTITFVADKATATV
SGIEVIGNYALADGKAKQTYKVTVTDANNNLVKDSDVTLTASPASLNLEPNGTATTNEQG
QAIFTATTTVAATYTLKAQVSQTNGQVSTKTAESKFVADDKNAVLTASSDMQSLVADGKS
TAKLEVTLMSANNPVGGNMWVDIQTPEGVTEKDYQFLPSKNDHFVSGKITRKFSTSKPGV
YTFTFNALTYGGYEMKPVTVTITAVDADTAKDEEAMK
NT seq 4254 nt   +upstreamnt  +downstreamnt
atgtcgcgttataaaacagatcataaacaaccacgatttcgttattcagttctggcccgc
tgcgtggcgtgggcaaatatctctgttcaggttctttttccactcgctgtcacctttacc
ccagtaatggcggcacgtgcgcagcatgcggttcagccacggttgagcatgggaaatact
acggtaactgctgataataacgtggagaaaaatgtcgcgtcgtttgccgcaaatgccggg
acatttttaagcagtcagccagatagcgatgcgacacgtaactttattaccggaatggcc
acagctaaagctaaccaggaaatacaggagtggctcgggaaatatggtactgcgcgcgtc
aaactgaatgtcgataaagatttctcgctgaaggattcttcgctggaaatgctttatccg
atttatgatacgccaacaaatatgttgttcactcagggagcaatacatcgtaccgacgat
cgtactcagtcaaatattggttttggctggcgtcatttttcaggaaatgactggatggcg
ggggtgaacacctttatcgaccatgatttatcccgtagtcatacccgcattggtgttggt
gcggaatactggcgcgattatctgaaactgagcgccaatggttatattcgggcttctggc
tggaaaaaatcgccggatattgaggattatcaggaacgcccggcgaatggttgggatatc
cgcgcagagggctatttacctgcctggccgcagcttggcgcaagcctgatgtatgaacag
tattatggcgatgaagtcgggctgtttggtaaagataagcgccagaaagacccgcatgct
atttctgccgaggtgacctatacgccagtgcctcttctgacactgagcgccgggcataag
cagggcaagagcggtgagaatgacactcgctttggcctggaagttaattatcggattggc
gaacctctggagaaacaactcgatacagacagcattcgcgagcgtcgaatgctggcaggc
agccgctatgacctggttgagcgtaataacaacatcgttcttgagtaccgcaaatctgaa
gtgatccgtattgctctgcctgagcgtattgaaggtaagggcggtcagacactttccctg
gggcttgtggtcagcaaagcaactcacggactgaaaaatgtgcagtgggaagcgccgtca
ttactggctgaaggtggcaaaattaccggtcagggtagtcagtggcaagtaacgctcccg
gcttatcgtccaggcaaagacaattattatgcgatttctgcggttgcctacgataacaaa
ggcaatgcctcaaaacgcgtgcagacagaggtggtcattaccggagcaggtatgagtgcc
gatcgcacggcgttaacgcttgacggtcagagccgtattcaaatgcttgctaacggtaat
gagcaaagaccgctggtgctgtctctgcgcgacgccgagggccagccagtcacgggcatg
aaagatcagatcaagactgaactaactttcaaaccggctggaaatattgtgactcgtacc
ctgaaggccactaaatcacaggcaaagccaacactgggtgagttcaccgaaactgaagcc
ggggtgtatcagtctgtctttactaccggaacgcagtcaggtgaggcaacgattactgtt
agtgttgatggcatgagcaaaaccgtcactgcagaactgcgggccacgatgatggatgtg
gcaaactccaccctgagcgctaacgagccgtcaggtgacgtggttgctgatggtcagcaa
gcctacacgctgacgctgactgcggtggatactgatggtaacccggtgacgggagaggcc
agccgcttgcgatttgttccgcaagacactaatggtgtcaccattggtacaatttcggag
ataaaaccaggcgtttacagcgccacggtttcttcgacccgtgccggaaacgttgttgtg
cgtgctttcagcgagcagtatcagctgggcacattacaacaaacgctgaagtttgttgcc
gggccgcttgatgcagcacattcgtccatcacactgaatcctgataaaccggtggttggc
ggtacagttacggcaatctggacggcaaaagatgctaatgacaaccctgtaactggtctc
aatccggatgcaccgtcattatcgggcgcagctgctgctggttctacggcatcaggctgg
acggataatggcgacgggacctggactgcgcagatttctctcggcactacggcgggtgaa
ttagaggttattccgaagctaaatggacaggatgcggcagcaaatgcggcaaaagtaacc
gtggtggctgatgcgttatcttcaaaccagtcgaaagtctctgtcgcagaagatcacgta
aaagccggcgaaagcacaaccgtgacgcttattgcaaaagatgcacatggcaacgctatc
agtggtctttccctgtcggcaagcctgacgggtgctgcgtctgaaggggcgactgtttct
ggttggaccgaaaaaggtgatggttcctatgtcgctacgctgacaacaggtggaaagacg
ggtgagcttctcgtcatgccgctattcaacggccagccagcagccaccgaagccgcgcag
ttgactgtcattgcgggggagatgtcatcagcgaactctacgcttgttgctgacaataag
gctccgaccgtcaaaacgacgacgaaactcaccttcaccgtgaaggatgcgtacgggaac
cttgtcaccgggctgaagccagatgcaccgcagtttagtggtgccgccagcacggggaca
gagcgaccttcaacaggagactggacagaaacaagtaatggggtctacgtggcgaccttg
actctgggatctgccgcgggccagttgtctgtgatgccgcgagtgaacggccaaaatgcc
gttgctcagccactggtgctgaatgttgctggtgacgcatctaaggctgagattcgtgat
atgacggtgaaggttgataaccagctggctaatggacaatcgactaaccaggtaaccctg
accgttgtggacacctatggtaacccgttgcagggacaaaatgtgacgctgactctgccg
aaaggtgtgaccagcaagacggggaatacggtaacaaccgatgcggcaggtaaagccgac
attgagctgatgtcaacggttgccggggaacacagcatcacggcctcagtgaataatgct
cagaagacggttacggtgaaattcaaggcggatttcagtaccggtcaggcgagtctggag
gttgatagcgccgcgccaaaagtagcaaacggcaaagatgcctttacgctgacggcgacc
gttgaggataaaaatggtaaccctgttccagggagcctggtgacctttaatctgccccgg
ggtgtcaagccgcttacaggcgataatgtctgggtgaaagccaacgatgaggggaaagca
gagttgcaggtggtttcagtgactgccggaacgtatgagatcacggcatcggcggggaat
agccagccttcggatacgcagactataacgtttgtagccgataaggctaccgcaaccgtc
tccggtattgaggtgattggcaactatgcgctggcggacggcaaagccaaacaaacgtat
aaagttacggtgactgatgccaataacaatttggtgaaagatagcgacgtgacgctgact
gccagcccggcttcgttaaacctggaaccgaatggcactgcgacaacgaatgagcaaggg
caggctattttcaccgctaccactactgttgcggcgacatacacactcaaggcgcaagtg
agtcagaccaacggtcaggtatcaacgaaaactgccgaatctaaattcgttgcggatgat
aaaaacgcggtactcaccgcatcatctgatatgcaatctctggtggcggatgggaaatcg
actgcgaagctggaggtgacactgatgtcggcaaacaaccccgttggcgggaatatgtgg
gtcgacattcagacgccggaaggggtgacggagaaggattatcagttcctgccgtcgaaa
aatgaccatttcgtgagcggaaaaatcacgcgtaaatttagtaccagcaagcctggtgtc
tatacgttcacatttaacgccctgacctatggcgggtacgaaatgaagccagtgacggtg
accattaccgcggtggatgccgatacggcaaaggacgaggaggcgatgaaataa

DBGET integrated database retrieval system