KEGG   Escherichia coli O9 HS (commensal): EcHS_A0352
Entry
EcHS_A0352        CDS       T00591                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: HTH_18 HTH_AraC GyrI-like
Other DBs
NCBI-ProteinID: ABV04740
Position
complement(366188..367045)
AA seq 285 aa
MIRQKILQQLLEWIECNLEHPISIEDIAQKSGYSRRNIQLLFRNFMHVPLGEYIRKRRLC
RAAILVRLTAKSMLDIALSLHFDSQQSFSREFKKLFGCSPREYRHRDYWDLANIFPSFLI
RQQQKTECRLVNFPETPIFGNSFKYDIEVSNKSPDEEVKLRRHHLARCMNNFKTDIYFVS
TFEPSTKSVDLLTVETFAGTVCKQTDSEMPKEWTINRGLYASFRYEGEWEHYPEWARNLY
LMELPARGLARVNGSDIERFYYNEDFVEKDSNDVVCEIFIPVRPV
NT seq 858 nt   +upstreamnt  +downstreamnt
atgatcaggcagaagattctacagcagctcctggagtggattgagtgcaatcttgagcac
cctatttcaatcgaagatatcgcacagaaatctggctacagcagacgcaacatccagctt
ctgttccgaaatttcatgcatgtgcctttgggagaatacattcgcaaacgaaggctttgc
cgtgccgctattcttgtccggctcaccgcgaaatctatgcttgatattgcactctctttg
cattttgattcacagcagtcattcagccgcgaatttaaaaagttattcggctgctctccc
cgtgaataccgccaccgtgattattgggatctcgcaaatatcttcccttcttttttaata
cgtcaacagcaaaagacggagtgtagattagtcaattttcctgagacacctatttttggc
aactcatttaaatatgacattgaagtgtcgaataaatcaccggatgaagaagtcaaactg
cgacgtcatcatttagccagatgtatgaataattttaagacggatatctatttcgtctcc
acgtttgaaccgtcaacaaaatcggtcgatttgctcacggttgaaacttttgccggtacg
gtatgcaaacaaaccgattcagagatgccgaaagagtggacaattaaccgaggactgtat
gcctctttccgctatgaaggtgagtgggagcactaccctgaatgggcgcgaaacctctat
ctgatggaattacccgccagggggttagccagagtgaacggcagtgatattgagcggttt
tattacaatgaagatttcgtagaaaaggatagcaatgatgttgtttgcgaaatttttatc
cccgttcgtccggtttag

DBGET integrated database retrieval system