KEGG   Escherichia coli O9 HS (commensal): EcHS_A0353
Entry
EcHS_A0353        CDS       T00591                                 

Definition
(GenBank) oxidoreductase, aldo/keto reductase family
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-ProteinID: ABV04741
Position
367294..368163
AA seq 289 aa
MEFSVLSNNLKMPMMGFGVFQVTDKNVCKQSVLNAIRTGYRLIDTAAVYGNEDAVGEAVR
EAISEGLCTRDELFITSKLWVQDMLNQDTAAAGIEASLKKSGLEYFDLYLLHQAMRDYFS
AWRALEDAYEEGKLKAIGVSNFYPHVLANFCETVRVKPMVNQVELHPYFAQPEALATMKY
YNVQPEAWAPLGGGRHKPFENNLLQSIADAHQKSISQVILRWNIQRGVVVIPKSTHQQRI
EENFAIWDFSLTEKEMAQISSLDLGYVGESVKHFNPEFVRGCLAVKIHD
NT seq 870 nt   +upstreamnt  +downstreamnt
gtggaattttccgtattaagtaacaatctgaaaatgccgatgatgggatttggtgttttt
caggttaccgataaaaacgtgtgcaaacagtcagtgttgaacgctatccgcacaggttat
cgactcatcgacactgcagcggtatacggtaatgaagatgccgtcggtgaagccgttcgt
gaagctatatctgaaggtttatgtacccgagatgagttatttataacgtctaaattgtgg
gtgcaggatatgttgaatcaggatacggcagcagcaggtattgaagcatcattaaaaaaa
tcgggactagagtacttcgacctctatttattgcaccaggctatgcgcgattatttcagt
gcgtggcgtgcactcgaagatgcctatgaagagggcaaattaaaagcaattggggtttcc
aatttctatcctcatgttctggcgaacttttgtgaaacggtaagagttaaaccgatggtc
aaccaggtcgagttgcatccctattttgcccaaccagaggcgctggcaaccatgaagtat
tataacgtgcagcctgaagcatgggctccgttaggtggtggacgacataaaccctttgaa
aataatctgcttcagagtattgcagatgcccatcaaaaatcgatttctcaagtcattctg
cgttggaatattcaacggggagtggtcgttattccgaaatcgacacatcaacagcgtatc
gaagaaaattttgctatctgggatttctcactgacagagaaagaaatggcacaaattagt
tcgcttgatttgggttatgttggggagtcggtaaaacattttaatcctgaatttgttcgt
ggttgtcttgctgtaaaaatacatgattga

DBGET integrated database retrieval system