KEGG   Escherichia coli O9 HS (commensal): EcHS_A0354
Entry
EcHS_A0354        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04743
Position
368899..369168
AA seq 89 aa
MQVFFHCEHPYLYNTAVAVELLSIRIDVTFQDEALYFLAISAMVSSRTVGDADTDETLIC
FRIILSSALVENAITPDNSVANKTDFLNI
NT seq 270 nt   +upstreamnt  +downstreamnt
gtgcaggtatttttccattgtgaacatccttatttatacaatactgctgttgcggttgaa
ttattatcaattcgcatcgatgtgactttccaggatgaagcattatattttctggctata
tcagcaatggtatcctccagaactgtcggtgatgctgatactgacgagacgctgatatgt
ttcagaattattttatcatctgcattggtggaaaatgccataacgccagataatagtgtt
gcaaataaaacagattttttaaacatataa

DBGET integrated database retrieval system