KEGG   Escherichia coli O9 HS (commensal): EcHS_A0355
Entry
EcHS_A0355        CDS       T00591                                 

Definition
(GenBank) putative membrane protein
  KO
K21741  reactive chlorine resistance protein C
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    EcHS_A0355
SSDB
Motif
Pfam: DUF417 TMEM72 DoxX
Other DBs
NCBI-ProteinID: ABV04742
Position
complement(368323..368916)
AA seq 197 aa
MEKYLHLLSRGDKIGLTLIRLSIAIVFMWIGLLKFVPYEADSITPFVANSPLMSFFYEHP
EDYKQYLTHEGEYKPEARAWQTANNTYGFSNGLGVVEVIIALLVLANPVNRWLGLLGGLM
AFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKDTLMLAGAVMIMADSARE
ILKQRSNESSSTLKTEY
NT seq 594 nt   +upstreamnt  +downstreamnt
atggaaaaatacctgcacctgttaagtcggggagataaaattggcctgacattgattcgt
ctgagtattgcaattgtttttatgtggattgggttattaaagtttgtcccttacgaggca
gacagcattacaccattcgtcgcaaacagtccactaatgtcgttcttttatgaacacccg
gaagactataaacagtatctgactcacgaaggcgaatacaaaccagaagcaagggcatgg
caaacggccaataatacctatggtttttccaacggtcttggcgtcgtggaggtgattatt
gctctgctggttttggctaatcctgtcaatcgctggttaggtttattgggaggactgatg
gcatttaccacgccgctggtaacactctcatttttaatcaccaccccggaggcatgggta
cccgcattgggtgacgctcatcatggtttcccttatttatccggtgctggtcgcctggta
ttgaaagatactctgatgctggcaggtgctgtcatgataatggcagattcggcgcgggaa
attcttaaacaacgcagtaatgaatccagttcaacgttaaaaactgaatattga

DBGET integrated database retrieval system