KEGG   Escherichia coli O9 HS (commensal): EcHS_A0356
Entry
EcHS_A0356        CDS       T00591                                 

Definition
(GenBank) pyridine nucleotide-disulphide oxidoreductase
  KO
K21739  probable pyridine nucleotide-disulfide oxidoreductase
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    EcHS_A0356
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 HI0933_like 3HCDH_N DAO GIDA 2-Hacid_dh_C Thi4 NAD_binding_8 TrkA_N FAD_binding_2 FAD_binding_3 UDPG_MGDP_dh_N AlaDh_PNT_C ApbA FAD_oxidored Lycopene_cycl Amino_oxidase adh_short
Other DBs
NCBI-ProteinID: ABV04744
Position
complement(369273..370598)
AA seq 441 aa
MNKYQAVIIGFGKAGKTLAVTLAKAGWRVALIEQSNAMYGGTCINIGCIPTKTLVHDAQQ
HTDFVRAIQRKNEVVNFLRNKNFHNLADMPNIDVIDGQAEFINNHSLRVHRPEGNLEIHG
EKIFINTGAQTVVPPIPGITTTPGVYDSTGLLNLKELPGHLGILGGGYIGVEFASMFANF
GSKVTILEAASLFLPREDRDIADNIATILRDQGVDIILNAHVERISHHENQVQVHSEHAQ
LAVDALLIASGRQPATASLHPENAGIAVNERGAIVVDKQLHTTADNIWAMGDVTGGLQFT
YISLDDYRIVRDELLGEGRRSTDDRKNVPYSVFMTPPLSRVGMTEEQARESGADIQVVTL
PVAAIPRARVMNDTRGVLKAIVDNKTQRILGASLLCVDSHEMINIVKMVMDAGLPYSILR
DQIFTHPSMSESLNDLFSLVK
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaataaatatcaggcagttattattggttttggcaaggctggaaaaacattagccgtc
acgctggcaaaagcaggttggcgagtggctctcatcgaacaatcaaatgcaatgtatggc
gggacctgtattaatatcggctgcatcccaaccaaaacattggttcatgacgcacagcag
cacacagattttgtccgtgccatacagcgtaaaaatgaagtggttaattttttacgtaat
aagaattttcataatcttgcggatatgcccaatatcgacgtgatcgacggccaggcggag
tttatcaataatcatagcctgcgtgttcatcggcctgagggaaatctggaaattcatggc
gagaaaatttttattaataccggtgcacaaaccgtggttccgccaattcctggaattacc
accacgcctggtgtatatgacagcaccggattacttaatctaaaagaattgcctgggcat
ttaggtattttgggcggcggatatattggcgttgagttcgcctctatgttcgctaatttt
ggcagcaaggtaaccattttagaagcagcttcgctgtttttgcctcgggaagatcgggat
attgctgataatatcgcgacgattttacgcgatcagggcgtcgatattatcctcaatgcc
catgtggagcgaatcagtcaccatgaaaatcaagtgcaagtgcatagcgagcacgcccaa
ctggcggtggatgcactgttaatagcttccggtcgtcaaccggctaccgcttcgttacat
ccagaaaatgccggtatcgcagtaaacgagcgcggggcaattgtcgttgacaagcaatta
cataccaccgcagacaatatttgggcgatgggagatgttaccggcgggctgcaatttact
tatatttcactggatgattaccgcattgtgcgtgatgagttgctgggagaaggcagacgt
agtactgatgatcggaaaaatgtgccttattccgtattcatgacaccgccactgtccagg
gttggtatgacagaagaacaggccagagagagtggtgctgatattcaggtggtgacattg
cctgtagctgcaattccgcgtgccagagtgatgaatgatactcgtggggtattaaaagcg
attgttgataataaaacccaacgtatattaggggcatcactgctgtgtgttgactcccac
gagatgatcaatatagtgaaaatggtgatggatgccgggctgccttatagcatattacgc
gatcagatatttactcatccgtcgatgagcgaatcactcaatgatctattttcattagtc
aaataa

DBGET integrated database retrieval system