KEGG   Escherichia coli O9 HS (commensal): EcHS_A0357
Entry
EcHS_A0357        CDS       T00591                                 

Definition
(GenBank) hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Other DBs
NCBI-ProteinID: ABV04745
Position
370678..370770
AA seq 30 aa
MIFCLIVWYFLFLNQNHKTKIMINHLMVLD
NT seq 93 nt   +upstreamnt  +downstreamnt
ttgatattttgtcttatcgtctggtattttctttttcttaatcagaatcacaaaacaaaa
atcatgattaaccatttgatggtattagattag

DBGET integrated database retrieval system