KEGG   Escherichia coli O9 HS (commensal): EcHS_A0358
Entry
EcHS_A0358        CDS       T00591                                 

Definition
(GenBank) transcriptional regulator, AraC family
  KO
K21746  AraC family transcriptional regulator, reactive chlorine species (RCS)-specific activator of rcl operon
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecx03000]
    EcHS_A0358
Transcription factors [BR:ecx03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    EcHS_A0358
SSDB
Motif
Pfam: HTH_18 Cupin_6 HTH_AraC AraC_binding Cupin_2
Other DBs
NCBI-ProteinID: ABV04746
Position
370824..371678
AA seq 284 aa
MDALSRLLMLNAPQGTIDKNCVLGSDWQLPHGAGELSVIRWHALTQGAAKLEMPTGEIFT
LRPGNVVLLPQNSAHRLSHVDNESTCIVCGTLRLQHSARYFLTSLPETLFLAPVNHSVEY
NWLREAIPFLQQESRSAMPGVDALCSQICATFFTLAVREWIAQVNTEKNILSLLLHPRLG
AVIQQMLEMPGHAWTVESLASIAHMSRASFAQLFRDVSGTTPLAVLTKLRLQIAAQMFSR
EMLPVVVIAESVGYASESSFHKAFVREFGCTPGEYRERVRQLAP
NT seq 855 nt   +upstreamnt  +downstreamnt
atggatgcccttagccgtttgttgatgcttaacgctccacaaggaacgatcgataagaat
tgcgtgttaggaagtgactggcagcttccacatggtgccggggaattatcggttattcgt
tggcatgcgttaacgcaaggagcggcgaagctggaaatgccgacgggagagatttttaca
ttacgcccgggaaatgtggtcctgctaccacaaaattcagctcatcgcctgagtcatgtc
gataatgaatcgacctgtattgtctgcggcactcttcggttgcaacattcggcgcgttat
tttttaacgtctttgccggaaacgctgtttttagcaccggttaaccacagcgtggaatat
aactggctgagggaggcgatcccgtttttacaacaggaatccagatcggcgatgccggga
gtggatgcactgtgtagccagatctgcgctacattctttaccctcgcggtgcgtgagtgg
attgcacaggttaatacagagaaaaacattctcagtttgcttctgcatccacgtcttggt
gcggtaatacagcaaatgctggaaatgccaggacacgcctggaccgtcgaatcgctggcc
agcatcgcccacatgtctcgggcaagttttgcccagcttttccgtgatgtttccggaacc
acgccgctggctgtattaacaaagttgcgtctacaaatagcggcccagatgttttcccgg
gaaatgctccctgttgtggtgatcgctgagtcagtaggctatgccagtgaatcatctttt
cacaaggcgtttgtccgcgagtttggttgtactccgggagaatatcgggaaagggtcaga
cagcttgcaccctga

DBGET integrated database retrieval system