KEGG   Escherichia coli O9 HS (commensal): EcHS_A0359
Entry
EcHS_A0359        CDS       T00591                                 

Definition
(GenBank) cysteine-rich domain protein
  KO
K18928  L-lactate dehydrogenase complex protein LldE
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    EcHS_A0359
SSDB
Motif
Pfam: CCG
Other DBs
NCBI-ProteinID: ABV04747
Position
372205..372924
AA seq 239 aa
MNVNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQPAINSGYIKEAIPGMK
NLIAALEDNDDPIISPAGSCTYAVKSYPTYLADEPEWASRAEKVAARMQDLTSFIVNKLG
VVDVGASLQGRAVYHPSCSLARKLGVKDEPLTLLKNVRGLELLTFAEQDTCCGFGGTFSV
KMAEISGEMVKEKVVHLMEVRPEYLIGADVSCLLNISGRLQREGQKVKVMHIAEVLMSR
NT seq 720 nt   +upstreamnt  +downstreamnt
gtgaatgtcaatttctttgtcacctgtattggtgacgccctgaaatcaagaatggcacga
gactccgtgctgctactggaaaaactcggctgtcgcgtaaatttcccggagaaacaggga
tgctgcggtcagcctgcgatcaatagtggttatatcaaagaagcgattccagggatgaaa
aatctgatcgccgcactggaggataacgacgatcccattatttcaccggctggctcttgc
acctatgccgtaaaaagttacccgacgtatctggcggatgaacctgaatgggcatcacga
gccgaaaaggttgccgcgcgtatgcaggatctcacctcttttattgttaataaattaggg
gtagtcgatgtaggtgccagtttgcaagggagagcggtgtatcacccatcttgtagcctg
gcccgtaagctgggggtgaaggacgagccacttacgctgctgaaaaatgtgcgtggactg
gagctgttgacctttgctgaacaggatacctgctgcggatttggcggcacgttctcggtc
aaaatggccgaaatatccggcgagatggtgaaagaaaaggttgtgcacctgatggaagtc
cgccctgagtatttaattggtgctgacgtgagttgcctgctgaacatcagtgggcgatta
caacgggaagggcagaaagtcaaagtgatgcatattgctgaagtgttgatgagccgctga

DBGET integrated database retrieval system