KEGG   Escherichia coli O9 HS (commensal): EcHS_A0360
Entry
EcHS_A0360        CDS       T00591                                 

Definition
(GenBank) iron-sulfur cluster binding protein
  KO
K18929  L-lactate dehydrogenase complex protein LldF
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    EcHS_A0360
SSDB
Motif
Pfam: LUD_dom Fer4_8 DUF3390 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_2 Fer4_16 Fer4 14-3-3 Fer4_4 Fer4_6 Fer4_13
Other DBs
NCBI-ProteinID: ABV04748
Position
372935..374362
AA seq 475 aa
MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDELGHWEEWRDRAAQIRD
HVLSNLDAYLYQLSEKVTQNGGHVWFAKTKEDATRYILQVAQRKNARKVVKSKSMVTEEI
GVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRHQIRRVLHERLGYEGPET
PEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNEGNARMCTTLPKTHIAVMG
MERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAGHVDGPEEFHLVIVDNGRSE
VLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGPIGAVISPLLGGYKDFKDLPY
ACSLCTACDSVCPVRIPLSKLILRHRRVMAEKGITAKAEQRAIKMFAYANSHPGLWKVGM
MAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGESFRSWFKKHQAQEKKNG
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgtcgatcaaaaccagtaatacagattttaagacacgcatccgtcagcaaattgaagat
ccgatcatgcgcaaagcggtggcaaacgcgcagcagcgtattggggcaaatcggcaaaaa
atggtcgatgaattggggcactgggaggagtggcgcgatcgggccgcccagatacgtgat
catgttctgagtaatctcgacgcttatctgtaccagctctcagaaaaagtgacgcaaaac
ggcggtcacgtctggtttgcaaaaaccaaagaagacgctacccgctacattttacaggtt
gcccaacgcaaaaatgcccggaaggtggtgaaatctaaatcgatggtgaccgaagagatt
ggtgtcaatcatgtgttgcaggatgctggcattcaggtgattgaaaccgatctgggtgaa
tatattctccagctggatcaagatccgccatctcatgttgtggtcccggcaattcataaa
gatcgccatcagatccgtcgagtgctacacgaacgtctgggctatgaggggccggaaacg
cctgaagcgatgaccttattcatccggcaaaaaatccgcgaagatttcctcagtgctgaa
ataggtattaccggctgtaatttcgcggtggcagagacaggttcggtatgcctggtgacc
aatgaaggtaatgcgcgaatgtgtaccacgctgcctaaaacgcatattgcagtgatggga
atggagcgtattgcccccacgtttgccgaggtagatgtattgatcaccatgctggcgcgc
agtgccgttggtgcacgtttgacgggatacaacacctggctgacaggaccgcgcgaagcg
gggcacgttgatggtcctgaagagtttcatctggttattgtcgataacgggcgttctgag
gtgctggcctctgaatttcgggatgtgctgcgctgtattcgctgcggggcttgtatgaat
acttgtccggcatatcgccatattggcggtcatggatatggctctatttatccagggcca
attggtgcggtgatttctccgctacttggcggctataaagattttaaagatttaccctac
gcctgctctttatgcactgcttgtgacagcgtgtgtccggtgcgtattccgctgtcaaaa
ctgattttgcgtcatcgtcgggtgatggctgaaaaagggatcaccgcaaaagcagagcaa
cgggcgataaaaatgttcgcttatgccaatagtcatccaggattgtggaaagtcgggatg
atggccggtgctcatgcggcaagctggtttatcaatggcggcaaaacaccactcaaattt
ggcgcgattagcgactggatggaagcacgcgatcttcctgaagctgacggagagagtttc
cgtagttggtttaagaaacatcaggcgcaggagaaaaagaatggataa

DBGET integrated database retrieval system