KEGG   Escherichia coli O9 HS (commensal): EcHS_A0361
Entry
EcHS_A0361        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00782  L-lactate dehydrogenase complex protein LldG
Organism
ecx  Escherichia coli O9 HS (commensal)
Brite
KEGG Orthology (KO) [BR:ecx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    EcHS_A0361
SSDB
Motif
Pfam: LUD_dom
Other DBs
NCBI-ProteinID: ABV04749
Position
374355..375050
AA seq 231 aa
MDNRSEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQRCDAFIQFASDVMLT
RCELTSEAKAAEAAIRLCKELGDQSVMISGDTRLEELGISERLQQECNAVVWDPAKGAEN
ISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPESSLFILRKSTILPRVAQLA
EKLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVKAVYLIIEDC
NT seq 696 nt   +upstreamnt  +downstreamnt
atggataatcggagcgaatttttgaataacgttgctcaggcactgggtcgcccgctgcga
cttgaaccgcaagcagaagatgcgccgcttaacaactatgctaacgagcggcttacccaa
cttaaccaacagcagcgctgtgacgcgtttattcagtttgccagcgatgttatgttgacg
cgctgtgagctgaccagcgaggcgaaggcggcagaagctgcaatacgtctgtgtaaagag
ctgggagatcagtcggtcatgattagcggtgacacgaggctggaggaattggggattagc
gaacgtttgcagcaggaatgcaatgccgttgtttgggatccggcgaaaggtgccgagaat
atctcgcaggcagagcaggctaaagtgggtgtcgtgtatgctgaatatggtttaaccgaa
tcgggaggcgtggttcttttttccgccgccgagcgcgggcgttcattgagcctgctcccg
gaatcttctctttttatcctgcgtaaaagcacaatcctgccgcgtgtagcgcaactcgca
gaaaaattgcatcagaaagcgcaggccggtgaacgaatgccgtcctgcattaacatcatt
agcggccctagttcaacggcggatattgagcttatcaaagtcgtcggggttcatggcccg
gtgaaagcggtgtatctgattattgaggattgctga

DBGET integrated database retrieval system