KEGG   Escherichia coli O9 HS (commensal): EcHS_A0362
Entry
EcHS_A0362        CDS       T00591                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Wzz LapA_dom DUF2059 GNVR DUF3139
Other DBs
NCBI-ProteinID: ABV04750
Position
complement(375293..375961)
AA seq 222 aa
MREQIKQDIDLIEILFYLKKKIRVILFIMAICMAMVLLFLYINKDNIKVIYSLKINQTTP
GILVSCDSNNNFACQTTMTEDVIQRITTFFQTSPDVKNREIRLEWSGDKRALPTAEEEIS
RVQASIIKWYASEYHNGRQVLDEIQTPSAINSELYTKMIYLTRNWSLYPNGDGCVTISSP
EIKNKYPAAICLALGFFLSIVISVMFCLVKKMVDEYQQNSGQ
NT seq 669 nt   +upstreamnt  +downstreamnt
atgcgtgaacaaatcaaacaggatatcgatctgattgagattttattttatctgaagaaa
aagattcgtgttatcctttttattatggctatatgtatggctatggtgctgttgtttctg
tatatcaataaagacaatataaaagtgatttacagcctaaaaataaaccagacaacgcca
ggtatacttgttagctgtgatagcaataataattttgcctgtcagaccacaatgactgaa
gatgttattcagcgaattactacattttttcagaccagcccagatgtcaagaacagagaa
ataaggctggaatggtcaggagataagagagctttaccaactgctgaagaggaaatatct
cgcgtgcaggcctctattatcaaatggtatgcgtcagaatatcataatggcaggcaagtt
ctcgatgagatacaaacgccttcagcaattaacagtgagctttatacaaaaatgatatac
ctgaccaggaactggtcattgtatccgaacggtgatggctgtgtaactataagctcacca
gaaataaaaaataaataccctgctgccatttgcctggctctgggattttttctaagcatt
gtaatttctgtaatgttttgccttgtcaaaaaaatggtagatgaataccaacaaaactct
gggcagtaa

DBGET integrated database retrieval system