KEGG   Escherichia coli O9 HS (commensal): EcHS_A0363
Entry
EcHS_A0363        CDS       T00591                                 

Definition
(GenBank) putative outer membrane autotransporter
Organism
ecx  Escherichia coli O9 HS (commensal)
SSDB
Motif
Pfam: Autotransporter Opacity DUF5633
Other DBs
NCBI-ProteinID: ABV04751
Position
complement(376124..378421)
AA seq 765 aa
MKNSKAFYRSALATAIVMALSAPAFAADNAVSTTPVTLDKDKTTLDQDVVISNTADQQIT
AVTINAADKDLNVTFGGHDITAESTADKKFLEGVKVSGDKNVVINATGSTITAQGEGTYV
RTAMVISSTGDVVVNGGNFVAKNEKSSATGISLEGATGNNVTLNGTTINAQGNKSSSNGS
TAIFAQKGSVLNGFKGDATDNITLAGSNIINGRIETIVIAKENTGTHTVNLNIKDGSVIG
AANNKQTIYASASAQGAGSATQNLNLSVADSTIYSDIHALSASENSAGTTTNVNMNVARS
YWEGNAYTFNSGDKAGSNLDINLSDSSVWKGKVSGAGDASVSLQNGSVWNVTGSSTVDAL
AVKDSTVNITKATVNTGTFASQNGTLIVDASSENTLDISGKASGDLRVYSAGSLDLINEQ
TAFISTGKDSTLKATGTTEGGLYQYDLTQGADGNFYFVKNTHKASNASSLIQAMAAAPAN
VANLQADTLSARQDAVRLSENDKGGVWIQYFGGKQKHTTAGNASYDLDVNGVMLGGDTRF
MTEDGSWLAGVAMSSAKGDMTTMQSKGDTEGYSFHAYLSRQYNNGIFIDTAAQFGHYSNT
ADVRLMNGGGTIKADFNTNGFGAMVKGGYTWKDGNGLFIQPYAKLSALTLEGVDYQLNGV
DVHSDSYNSVLGEAGTRVGYDFAVGNSTVKPYLNLAALNEFSDGNKVRLGDESVNASIDG
AAFRVGAGVQADITKNMGAYASLDYTKGDDIENPLQGVVGINVTW
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgaaaaacagtaaggcattttaccgcagcgcattagcgacagctattgttatggctctt
tctgcaccagcattcgctgctgataacgcggtatcaactacaccggttacactggataaa
gataagacaactctggatcaagatgttgttattagcaatacagcagaccaacagattaca
gccgtaacaattaatgcggcagataaagatcttaatgttacttttggcggtcatgatatt
actgctgaatcaacggcagacaaaaaattccttgaaggtgtaaaagttagcggtgacaaa
aatgttgtgattaatgctacaggctccaccatcacagctcaaggtgaaggcacctatgtc
cggactgcaatggtcatttcttcaactggcgatgttgttgttaatggcggtaatttcgtt
gcaaaaaatgaaaaaagtagtgcgacaggaatatctctggaaggggccacgggaaataat
gtaacgctaaatggtacaaccataaatgctcaaggtaataagagttccagcaacggctct
acggcaatttttgctcaaaagggtagcgtattgaatggttttaaaggtgatgcaaccgac
aacattacccttgctggctcaaatattattaatggccggattgaaacaatagttattgcc
aaggagaatacgggaactcatacagtcaatctgaatattaaggatggctcagtaattggg
gcggctaataataaacaaacaatttatgcttctgcttcggcacaaggagcaggttcagca
acgcaaaatttaaatttatctgtcgccgattcaaccatctactctgatatccatgccctt
tctgcaagcgagaattcagccggtaccacaacaaatgtaaacatgaacgttgcccgctct
tactgggaaggtaatgcttataccttcaatagcggcgataaagcgggtagtaatctggat
ataaatctttccgatagctcagtctggaaaggcaaagtttcaggggcaggagatgccagt
gtatctctgcaaaacgggtctgtctggaatgttacgggatcctcaactgttgatgctctg
gcagtaaaagacagtacggttaatatcacgaaggctacagtcaatactggcacgtttgct
tctcagaacggcactctgattgttgatgcctcttctgaaaacactctggatatcagcgga
aaagcgagcggtgacttgcgtgtttacagtgcgggttcattggatcttatcaatgaacaa
acggcatttatttctaccggcaaagacagcactctaaaagccacaggcacaacggaaggt
ggtctgtatcaatatgacctgacacagggagctgatggtaacttttatttcgtaaaaaac
acgcataaagcatccaacgccagctccctgattcaggcaatggcagcagctccggctaac
gttgctaatctgcaggctgacacgctctcagcccgtcaggatgctgtccgtctgagcgaa
aatgacaagggcggcgtatggattcagtactttggcggtaaacagaaacataccaccgcg
ggaaatgcatcctatgacctggatgtaaacggtgtaatgctgggtggtgatacccgcttc
atgactgaagatggtagctggctggcaggtgtagcgatgtcttctgcgaaaggtgacatg
accaccatgcagagcaaaggcgacactgaaggttacagcttccacgcttacctgagccgc
cagtataacaacggtatcttcattgatactgctgcacagtttggtcactacagcaacacg
gcagatgttcgcctgatgaatggtggcggtaccatcaaagctgactttaacaccaatggt
ttcggtgcgatggttaaaggcggttacacatggaaagacggtaatggcctgtttattcag
ccatatgccaaactgtctgcgctgacgctggaaggtgtggattatcagctcaacggcgtg
gacgttcattctgacagctataactctgtgctgggtgaggccggtacgcgcgtgggttat
gacttcgctgtgggcaactcgaccgttaaaccttatctgaatctggccgcactgaacgaa
ttctctgatggcaacaaagtccgtctgggtgatgagtctgtcaatgccagcattgacggt
gcagcattccgcgtgggtgcaggtgtacaggctgatatcaccaaaaacatgggagcatat
gcaagccttgactacaccaaaggtgacgacattgagaacccgctacagggtgtagttggt
atcaatgtgacctggtaa

DBGET integrated database retrieval system